SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013604 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013604
Domain Number 1 Region: 45-159
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 8.21e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013604   Gene: ENSPANG00000018352   Transcript: ENSPANT00000009724
Sequence length 174
Comment pep:novel chromosome:PapAnu2.0:4:7943048:7965606:-1 gene:ENSPANG00000018352 transcript:ENSPANT00000009724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYL
LGSTAEEKAIVQQWLEYRVTQIDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILL
YYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Download sequence
Identical sequences A0A096NKU7 A0A1D5RAH4 A0A2K5MXZ3 A0A2K5YM71 A0A2K6CJK2 G8F402
ENSPANP00000013604 ENSMMUP00000028459 NP_001248271.1.72884 XP_005554142.1.63531 XP_011749150.1.29376 XP_011845021.1.47321 XP_011886644.1.92194 ENSMMUP00000028459 9544.ENSMMUP00000028459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]