SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013622 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013622
Domain Number 1 Region: 972-1174
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0000000000275
Family WD40-repeat 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013622
Domain Number - Region: 525-578
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.00126
Family RILP dimerisation region 0.0081
Further Details:      
 
Domain Number - Region: 40-176
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00157
Family BAR domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013622   Gene: ENSPANG00000018354   Transcript: ENSPANT00000000969
Sequence length 1337
Comment pep:known_by_projection chromosome:PapAnu2.0:20:1589738:1651856:1 gene:ENSPANG00000018354 transcript:ENSPANT00000000969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEIQMDEGGGVVVYQDDYCSGSVMSERVSGLAGSIYREFERLIHCYDEEVVKELMPLVV
NVLENLDSVLSENQEHEVELELLREDNEQLLTQYEREKALRRQAEEKFIEFEDALEQEKK
ELQIQVEHYEFQTRQLELKAKNYADQISRLEERESEMKKEYNALHQRHTEMIQTYVEHIE
RSKMQQVGGNSQTESSSGPSIRKERPTSLNVFPLADGTVRAQMGGKLVPAGDHWHLSDLG
QLQSSSSYQCPQDEMSESGQSSAAATPSTTGTKSNTPTSSVPSAAVTPLNETLQPLGDYG
VGSKSSKRAREKRDSRNMEVQVTQEMRNVSIGMGSSDEWSDVQDIIDSTPELDMCPETRL
DRTGSSPTQGIVNKAFGINTDSLYHELSTAGSEVIGDVDEGADLLDEETVRDDFFGMGKE
VGNLLLENSQLLETKNALNVVKNDLIAKVDQLSGEQEVLRGELEAAKQAKVKLENRIKEL
EEELKRVKSEAIIARREPKEEAEDVSSYLCTESDKIPMAQRRRFTRVEMARVLMERNQYK
ERLMELQEAVRWTEMIRASREHPSVQEKKKSTIWQFFSRLFSSSSSPPPAKRPYPSVNIH
YKSPTTAGFSQRRSHAMCPISAGSRPLEFFPDDDCTSSARREQKREQYRQVREHVRNDDG
RLQACGWSLPAKYKQLSPNGGQEDTRMKNVPVPVYCRPLVEKDPTMKLWCAAGVNLSGWR
PNEDDGGNGVKPAPGRDPLTCDREGDGEPKSAHGSPEKKKAKELPEMDATSSRVWILTST
LTTSKVVIIDANQPGTVVDQFTVCNAHVLCISSIPAASDSDYPPGEMFLDSDVNPEDPGV
DGVLAGITLVGCATRCNVPRSNCSSRGDTPVLDKGQGEAAAIANGKVNPSQSTEEATEAT
EVPDPGPSEPETATLRPGPLTEHVFTDPAPTPSSGPQPGSENGPEPDSSSTQPEPEPSGD
PTGAGSSAAPTMWLGAQNGWLYVHSAVANWKKCLHSIKLKDSVLSLVHVKGRVLVALADG
TLAIFHRGEDGQWDLSNYHLMDLGHPHHSIRCMAVVYDRVWCGYKNKVHVIQPKTMQIEK
SFDAHPRRESQVRQLAWIGDGVWVSIRLDSTLRLYHAHTHQHLQDVDIEPYVSKMLGTGK
LGFSFVRITALLVAGSRLWVGTGNGVVISIPLTETVVLHRGQLLGLRANKTSPTSGEGAR
PGGIIHVYGDDSSDRAASSFIPYCSMAQAQLCFHGHRDAVKFFVSVPGNVLATLNGSVLD
SPAEGPGPAAPASEAEGQKLRNVLVLSGGEGYIDFRIGDGEDDETEEGTGDISQVKPVLS
KAERSHIIVWQVSYTPE
Download sequence
Identical sequences ENSPANP00000013622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]