SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013687 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013687
Domain Number 1 Region: 183-306
Classification Level Classification E-value
Superfamily PH domain-like 2.18e-26
Family Third domain of FERM 0.0048
Further Details:      
 
Domain Number 2 Region: 84-180
Classification Level Classification E-value
Superfamily Second domain of FERM 1.03e-23
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 3 Region: 1-83
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.12e-20
Family First domain of FERM 0.0018
Further Details:      
 
Domain Number 4 Region: 381-430
Classification Level Classification E-value
Superfamily RING/U-box 0.00000812
Family RING finger domain, C3HC4 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013687   Gene: ENSPANG00000017017   Transcript: ENSPANT00000000102
Sequence length 445
Comment pep:known_by_projection chromosome:PapAnu2.0:4:16053344:16070908:1 gene:ENSPANG00000017017 transcript:ENSPANT00000000102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCYVTRPDAVLMEVEVEAKANGEDCLNQVCRRLGIIEVDYFGLQFTGSKGESLWLNLRN
RISQQMDGLAPYRLKLRVKFFVEPHLILQEQTRHIFFLHIKEALLAGHLLCSPEQAVELS
ALLAQTKFGDYNQNTAKYNYEELCAKELSSATLNSIVAKHKELEGTSQASAEYQVLQIVS
AMENYGIEWHSVRDSEGQKLLIGVGPEGISICKDDFSPINRIAYPVVQMATQSGKNVYLT
VTKESGNSIVLLFKMISTRAASGLYRAITETHAFYRCDTVTSAVMMQYSRDLKGHLASLF
LNENINLGKKYVFDIKRTSKEVYDHARRALYNAGVVDLVSRSNQSPSHSPLKSSESSMNC
SSCEGLSCQQTRALQEKLRKLKEAMLCMVCCEEEINSTFCPCGHTVCCESCATQLQSCPV
CRSHVEHVQHVYLPTHTSLLNLTVI
Download sequence
Identical sequences A0A096NL29 A0A0D9R5F6 A0A2K5NU78 A0A2K5V8H0 A0A2K5XX19 A0A2K6DG22
XP_005554036.1.63531 XP_007971813.1.81039 XP_011740896.1.29376 XP_011823322.1.47321 XP_011886755.1.92194 ENSPANP00000013687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]