SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013699 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013699
Domain Number 1 Region: 45-241
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 2.09e-76
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.0000114
Further Details:      
 
Domain Number 2 Region: 323-450
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 3.92e-53
Family C-terminal domain of adenylylcyclase associated protein 0.00000124
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013699
Domain Number - Region: 235-271
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000167
Family Formin homology 2 domain (FH2 domain) 0.12
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013699   Gene: ENSPANG00000019959   Transcript: ENSPANT00000022482
Sequence length 472
Comment pep:known_by_projection chromosome:PapAnu2.0:4:17360926:17524131:1 gene:ENSPANG00000019959 transcript:ENSPANT00000022482 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANMQGLVERLERAVSRLESLSAESHRPPGDCGEVNGVSGGVAPSVEAFDKLMNSMVAEF
LKNSRILAGDVETHAEMVHSAFQAQRSFLLMASQYQQPHENDVATLLKPISEKIQEIQTF
RERNRGSNMFNHLSAVSESIPALGWIAVSPKPGPYVKEMNDAATFYTNRVLKDYKHSDLR
HVDWVKSYLNIWSELQAYIKEHHTTGLTWSKTGPVASTVSAFSVLSSGPGLPPPPPPPPP
PGPPPLFENEGKKEESSPSRSALFAQLNQGEAITKGLRHVTDDQKTYKNPSLRAQGGQTR
SPTKSHTPSPTSPKSHPSQKHAPVLELEGKKWRVEYQEDRNDLVISETELRQVAYIFKCE
KSTLQIKGKVNSIIIDNCKKLGLVFDNVVGIVEVINSQDIQIQVMGRVPTISINKTEGCH
IYLSEDALDCEIVSAKSSEMNILIPQDGDYVSTFQTAVKNFSGAFIINILRD
Download sequence
Identical sequences ENSPANP00000013699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]