SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013712 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000013712
Domain Number - Region: 8-81
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family BAR domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013712   Gene: ENSPANG00000021608   Transcript: ENSPANT00000007786
Sequence length 88
Comment pep:known_by_projection chromosome:PapAnu2.0:10:90692146:90706310:-1 gene:ENSPANG00000021608 transcript:ENSPANT00000007786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADADPEERNYDNMLKMLSDLNKDLEKLLEEMEKISVQATWMAYDMVVMRTNPTLAESMR
RLEDAFVNCKEEMEKNWQELLHETKQRP
Download sequence
Identical sequences A0A096NL54 A0A2J8XTP4 A0A2K5K2T4 A0A2K5MY36 A0A2K5TPX9 A0A2K5Z2N5 A0A2K6DFG9 A0A2K6M529 A0A2K6RNU4 H9ES48
ENSPANP00000013712 NP_001180282.1.72884 XP_002831356.1.23681 XP_005566927.1.63531 XP_005566928.1.63531 XP_009232811.1.23681 XP_010353243.1.97406 XP_011753059.1.29376 XP_011753060.1.29376 XP_011797615.1.43180 XP_011840958.1.47321 XP_011917744.1.92194 XP_011917745.1.92194 XP_015006127.1.72884 XP_015006128.1.72884 XP_015006129.1.72884 XP_015006130.1.72884 XP_015312479.1.63531 XP_015312480.1.63531 XP_015312481.1.63531 XP_015312483.1.63531 XP_017743609.1.44346 XP_017743610.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]