SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013713 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013713
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.97e-110
Family Motor proteins 0.0000000188
Further Details:      
 
Domain Number 2 Region: 371-471
Classification Level Classification E-value
Superfamily SMAD/FHA domain 1.54e-22
Family FHA domain 0.00056
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013713
Domain Number - Region: 814-886
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0425
Family PLC-like (P variant) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013713   Gene: ENSPANG00000011103   Transcript: ENSPANT00000024853
Sequence length 1743
Comment pep:known_by_projection chromosome:PapAnu2.0:4:17715662:17808107:-1 gene:ENSPANG00000011103 transcript:ENSPANT00000024853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQEVVFKCLGEGILEKAFQGYNACIFAYGQTGSGKSFSMMGHAEQLGLIPRLCCALFKRI
SLEQNESQTFKVEVSYMEIYNEKVRDLLDPKGSRQSLKVREHKVLGPYVDGLSQLAVTSF
EDIESLMSEGNKSRTVAATNMNEESSRSHAVFNIIITQTLYDLQSGNSGEKVSKVSLVDL
AGSERVSKTGAAGERLKEGSNINKSLTTLGLVISSLADQAAGKGKNKFVPYRDSVLTWLL
KDNLGGNSQTSMIATISPAADNYEETLSTLRYADRAKRIVNHAVVNEDPNAKVIRELREE
VEKLREQLSQAEAMKAPELKEKLEESEKLIKELTVTWEEKLRKTEEIAQERQRQLESMGI
SLEMSGIKVGDDKCYLVNLNADPALNELLVYYLKDHTRVGADTSQDIQLFGIGIQPEHCE
IDIASDGDVTLTPKENARSCVNGTLVCSTTQLWHGDRILWGNNHFFRINLPKRKRRDWLK
DFEKETGPPEHDLDAASEASSEPDYNYEFAQMEVIMKTLNSNGSLDPVQNVVQVLEKQYL
EEKRSALEEQRLMYERELEQLRQQLSPDRQPPSSSPDRLAYSSQTAQQKVTQWAEESHSV
FQVSLDKIKMSLIKANTLVREANFLAEEMSKLTDYQVTLQIPAANLSANRKRGAIVSEPA
IQVRRKGKSTQVWTIEKLENKLIDMRDLYQEWKEKVPEAKRLCGKRGDPFYEAQENHNLI
GVANVFLECLFCDVKLQYAVPIISQQGEVAGRLHVEVMRVTGAVPERVVEDDSSENSSES
GSLEVVDSSGEIIHRVKKLTCRVKIKEATGLPLNLSNFVFCQYTFWDQCESTVAAPVVDP
EVPSPQSKDAQYTVTFSHCKDYVVNVTEEFLEFISDGALAIEVWGHRCAGNGTSLWEVDS
LHAKTRTLHDRWNEVTRRIEMWISILELNELGEYAAVELHQAKDVNTGGIFQLRQGHSRR
VQVTVKPVQHSGTLPLMVEAILSVSIGCVTARSTKLQRGLDSYQRDDEDGDDMDSYQEED
LNCVRERWSDALIKRREYLDEQIKKVSNKTAEKTEDDVEREAQLVEQWVGLTEERNAVLV
PAPGSGIPGAPADWIPPPGMETHIPVLFLDLNADDLSANEQLVGPHASGVNSILPKEHGS
QFFYLPIIKHSDDEVSATASWDSSVHDSVHLNRVTPQNERIYLIVKTTVQLSHPAAMELV
LRKRIAANIYNKQQSFTQSLKRRISLKNIFYSCGVTYEIVSNIPKATEEIEDRETLALLA
ARSENEGTSDGETYIEKYTRGVLQVENILSLERLRQAVTVKEALSTKARHIRRSLSTPNV
HNVSSSRPDLSGFDEDDKGWPENQLDMSDYSSSYQDVACYGTLPRDSPRRNKEGSGCTSE
TPHALTVSPFKAFSPQPPKFFKPLMPVKEEHKRRIALEARPLLSQESMPPPQAHNPGCIV
PSGSNGSSMPVEHNSKREKKIDSEEEENELEAINRKLISSQPYVPVEFADFSVYNASLEN
REWFSSKVDLSNSRVLEKEVSRSPTTSSITSGYFSHSASNATLSDMVVPSSDSSDQLAIQ
TKDADSTEHSTPSLVHDFRPSSNKELTEVEKGLVKDKIIMVPLKENSALVKGSPSSQSIP
EKNSKSLCRTGSCSELDGSVQNSPSKISQPARGFCPREVTVEHTTSILEDHSFTEFMGVS
EGKDFDGLTDSSAGELSSRRNLPNKTGSKTVSDGLHHPSQLHSKLENDQVIIPEAALWVM
CCR
Download sequence
Identical sequences ENSPANP00000013713

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]