SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013734 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013734
Domain Number 1 Region: 28-287
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 8.31e-83
Family Eukaryotic proteases 0.0000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013734   Gene: ENSPANG00000006412   Transcript: ENSPANT00000011881
Sequence length 315
Comment pep:known_by_projection chromosome:PapAnu2.0:20:2574826:2583499:1 gene:ENSPANG00000006412 transcript:ENSPANT00000011881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GARGGRGGARPLERRGLGKPESDEAVPLTIRGPCGQRVITTRIVGGLDAELGRWPWQGSL
RLWDSHVCGASLLSHRWALTAAHCFEEESDLSDPSGWTIQFGQLTSMPSFWSLQAYYTRY
FVSNIYLSPRYLGNSPYDIALVKLSAPVTYTNHIQPICLQASTFEFQNRTDCWVTGWGNI
KEDEELPSPYTLQEVQVAIINNSMCNYLFFKYSFRTDIFGDMVCAGDAQGEKDSCFGDSG
GPLACNKNGLWYQIGVVSWGVGCGRPNRPGVYTNVSYHFGWIQKLMAQSGMSQPDPSWPL
LFLPLLWALPLLGPA
Download sequence
Identical sequences ENSPANP00000013734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]