SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013745 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013745
Domain Number 1 Region: 17-131
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-28
Family Kringle modules 0.00091
Further Details:      
 
Domain Number 2 Region: 218-268
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000000811
Family Spermadhesin, CUB domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013745   Gene: ENSPANG00000000694   Transcript: ENSPANT00000020723
Sequence length 271
Comment pep:known_by_projection chromosome:PapAnu2.0:20:2768311:2770878:1 gene:ENSPANG00000000694 transcript:ENSPANT00000020723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTQDLQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPC
LFWDQTQQHSYSSASDPQGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPTCH
MPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDL
ARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYG
PDRNCSWALGPPGAALELTFRLFELADPRDR
Download sequence
Identical sequences ENSPANP00000013745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]