SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013803 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013803
Domain Number 1 Region: 15-188
Classification Level Classification E-value
Superfamily EF-hand 7.45e-23
Family Calmodulin-like 0.013
Further Details:      
 
Domain Number 2 Region: 153-270
Classification Level Classification E-value
Superfamily EF-hand 0.000000000000535
Family Calmodulin-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013803   Gene: ENSPANG00000016594   Transcript: ENSPANT00000024535
Sequence length 276
Comment pep:known_by_projection chromosome:PapAnu2.0:4:25576154:25625657:1 gene:ENSPANG00000016594 transcript:ENSPANT00000024535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAREPTPGRLDAACFWQVWQRFDADEKGYIEEKELDAFFLHMLMKLGTDDTVMKANLH
KVKQQFMTTRDASKDGHIQMKELAGMFLSEDENFLLVFRRENPLDSSVEFMQIWRKYDAD
SSGFISAAELRNFLRDLFLHHRKAISEAKLEEYTGTMMKIFDRNKDGRLDLNDLARILAL
QENFLLQFKMDACSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGV
DLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP
Download sequence
Identical sequences A0A096NLE5 A0A2K5M0P6 A0A2K6DFW1 F7HSJ7 G7P4K7
ENSMMUP00000003465 XP_001082266.1.72884 XP_005553883.1.63531 XP_011741039.1.29376 XP_011886901.1.92194 9544.ENSMMUP00000003465 ENSPANP00000013803 ENSMMUP00000003465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]