SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013823 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013823
Domain Number 1 Region: 11-110
Classification Level Classification E-value
Superfamily Histone-fold 4.66e-32
Family Nucleosome core histones 0.00000535
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013823   Gene: ENSPANG00000007362   Transcript: ENSPANT00000024849
Sequence length 111
Comment pep:novel chromosome:PapAnu2.0:4:26165365:26166383:1 gene:ENSPANG00000007362 transcript:ENSPANT00000024849 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIFTFINITSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARLGGVKRISGLIY
EETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Download sequence
Identical sequences ENSPANP00000013823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]