SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013845 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000013845
Domain Number - Region: 360-384
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0046
Family Integrin beta EGF-like domains 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013845   Gene: ENSPANG00000019368   Transcript: ENSPANT00000026527
Sequence length 506
Comment pep:known_by_projection chromosome:PapAnu2.0:20:4876582:4885833:-1 gene:ENSPANG00000019368 transcript:ENSPANT00000026527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASTGRWLLLRLALLGFLWEASGGLDSGASRDDDLLLPYPPRDCTRVRAGRREHESWPP
PPATPGAGGLAVRTFVSHFRDRAVTGHLTRAVAPLLTFSVLEPGGPGGCAARRRATVEET
ARAAGCRVAQNGGFFRMNTGECLGNVVSDERRVSSSGGLQNAQFGIRRDGTLVIGYLSEE
EVLDTENPFVQLLSGVVWLIRNGSIYINESQATECDETQETGSFSKFVNVISARTAIGHD
RKGQLVLFHADGQTEQRGINLWEMAEFLLKQDVVNAINLDGGGSATFVLNGTLASYPSDH
CQDNMWRCPRQVSTVVCVHEPRCQPPDCHGHGTCVDGHCQCTGHFWRGPSCGELDCGPSN
CSQHGLCTETGCRCDAGWTGSNCSEVASLKISGDGVARTCTACHDCLCCSLHMKPLQCSR
SLESTQQSPTWGFSPVCRTTWLALTLALAFLLLVSIAANLSLLLSRAERNRRLRGDYAYH
PLQEMNGELLAVEKEQPGGAHNPFKD
Download sequence
Identical sequences ENSPANP00000013845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]