SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013876 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013876
Domain Number 1 Region: 61-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.14e-16
Family Cold shock DNA-binding domain-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013876   Gene: ENSPANG00000020274   Transcript: ENSPANT00000022753
Sequence length 158
Comment pep:known_by_projection chromosome:PapAnu2.0:20:8660700:8664791:-1 gene:ENSPANG00000020274 transcript:ENSPANT00000022753 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APRASSPSRSAMSSEPPPPPQPPTHQASVGLLDTPRTRERSPSPLRGNVVPSPLPTRRTR
TFSATVRASQGPVYKGVCKCFCRSKGHGFITPADGGPDIFLHISDVEGEYVPVEGDEVTY
KMCSIPPKNEKLQAVEVVITHLAPGTKHETWSGHVVSS
Download sequence
Identical sequences ENSPANP00000013876

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]