SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013877 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013877
Domain Number 1 Region: 308-492
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-69
Family SPRY domain 0.00000325
Further Details:      
 
Domain Number 2 Region: 91-151
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.11e-18
Family B-box zinc-binding domain 0.0011
Further Details:      
 
Domain Number 3 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 2.29e-18
Family RING finger domain, C3HC4 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013877   Gene: ENSPANG00000006411   Transcript: ENSPANT00000012306
Sequence length 513
Comment pep:known_by_projection chromosome:PapAnu2.0:4:28550950:28573450:-1 gene:ENSPANG00000006411 transcript:ENSPANT00000012306 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGSVAECLQQETTCPVCLQYFAEPMMLDCGHNICCACLARCWGTAETNVSCPQCRETF
PQRHMRPNRHLANVTQLVKQLRTERPSGPGGEMGVCEKHREPLKLYCEEDQMPICVVCDR
SREHRGHSVLPLEEAVEGFKEQIQNQLDHLKRVKDLKKRRRAQGEQARAELLSLTQMERE
KIVWEFEQLYHSLKEHEYRLLARLEELDLAIYNSINGAITQFSCNISHLSSLIAQLEEKQ
QQPTRELLQDIGDTLSRAERIRIPEPWITPPDLQEKIHIFAQKCLFLTESLKQFTEKMQS
DMEKIQELREAQLYSVDVTLDPDTAYPSLILSDNLRQVRYSYLQQDLPDNPERFNLFPCV
LGSPCFIAGRHYWEVEVGDKAKWTIGVCEDSVCRKGGVTSAPQNGFWAVSLWYGKEYWAL
TSPMTALPLRTPLQRVGIFLDYDAGEVSFYNVTERCHTFTFSHATFCGPVRPYFSLSYSG
GKSAAPLIICPMSGIDGFSGHVGNHGHSMETSP
Download sequence
Identical sequences A0A096NLL9 A0A0D9R6T3 A0A1U9X8R9 A0A2I3HN16 A0A2K5KG03 A0A2K5N1H5 A0A2K5TQT7 A0A2K5YG76 A0A2K6B8E9 A0A2K6K2G8 A0A2K6Q3B6 F7DCK3 G3RIJ4 H2QSK5 K7EUW2 P14373
ENSPANP00000013877 ENSPPYP00000018307 ENSP00000366399 ENSP00000383555 ENSP00000388622 ENSP00000392787 ENSP00000412445 ENSPTRP00000030492 ENSPTRP00000030492 ENSP00000366404 ENSP00000383555 ENSP00000392787 ENSP00000405229 ENSP00000414793 ENSP00000366404 ENSP00000383555 ENSP00000392787 ENSP00000405229 ENSP00000414793 9544.ENSMMUP00000020993 9598.ENSPTRP00000030492 9606.ENSP00000366404 9606.ENSP00000383555 9606.ENSP00000392787 9606.ENSP00000405229 9606.ENSP00000414793 ENSPPYP00000024339 ENSNLEP00000005586 ENSMMUP00000020993 NP_001247721.1.72884 NP_006501.1.87134 NP_006501.1.92137 XP_001140726.2.37143 XP_002816642.1.23681 XP_003272048.1.23891 XP_003829755.1.60992 XP_005553766.1.63531 XP_007971529.1.81039 XP_010375560.1.97406 XP_011756429.1.29376 XP_011800271.1.43180 XP_011846663.1.47321 XP_011931409.1.92194 XP_017744635.1.44346 XP_018885373.1.27298 gi|5730009|ref|NP_006501.1| ENSMMUP00000020993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]