SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013892 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013892
Domain Number 1 Region: 171-577
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.41e-88
Family L-arabinose binding protein-like 0.00051
Further Details:      
 
Domain Number 2 Region: 103-159
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000195
Family Complement control module/SCR domain 0.0000354
Further Details:      
 
Domain Number 3 Region: 56-103
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000361
Family Complement control module/SCR domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013892   Gene: ENSPANG00000009408   Transcript: ENSPANT00000022999
Sequence length 937
Comment pep:known_by_projection chromosome:PapAnu2.0:4:29234413:29262431:-1 gene:ENSPANG00000009408 transcript:ENSPANT00000022999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLLLLLLAPLFLRPPGAGGAQTPNATSEGCQIIHPPWEGGIRYRGLTRDQVKAINFLPV
DYEIEYVCRGEREVVGPKVRKCLANGSWTDMDTPSRCVRICSKSYLTLENGKVFLTGGDL
PALDGARVDFRCDPDFHLVGSSRSICSQGQWSTPKPHCQVNRTPHSERRAVYIGALFPMS
GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIK
IILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVK
LFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDA
RIIVGLFYETEARKVFCEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAV
EGHITTEIVMLNPANTRSISNMTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALAL
ALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLI
EQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLS
SLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHIGRNQF
PFVCQARLWLLGLGFSLGYGSMFTKIWWVQCACSPHIFIQTLEPWKLYATVGLLVGMDVL
TLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLL
GIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMILSSQQDAAFAFASLAIVF
SSYITLVVLFVPKMRRLITRGEWQSEAQDTMKTGSSTNNNEEEKSRLLEKENRELEKIIA
EKEERVSELRHQLQSRQQLRSRRRLSCDGSRVHLLYK
Download sequence
Identical sequences ENSPANP00000013892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]