SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013900 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013900
Domain Number 1 Region: 28-141
Classification Level Classification E-value
Superfamily SH2 domain 7.94e-24
Family SH2 domain 0.0003
Further Details:      
 
Domain Number 2 Region: 146-192
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000131
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013900   Gene: ENSPANG00000000526   Transcript: ENSPANT00000012316
Sequence length 193
Comment pep:known_by_projection chromosome:PapAnu2.0:20:10600848:10601489:-1 gene:ENSPANG00000000526 transcript:ENSPANT00000012316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVAHNQVAADNAVSTAAEPRRRPEPSSSSSSSPDTHFRTFRSHADYRRITRASALLDACG
FYWGPLSVHGAHERLRAEPVGTFLVRDSRQRNCFFALSVKMASGPTSIRVHFQAGRFHLD
GSRESFDCLFELLEHYVAAPRRMLGTPLRQRRVRPLQELCRQRIVATVGRENLARIPLNP
VLRDYLSSFPFQI
Download sequence
Identical sequences ENSPANP00000013900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]