SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013906 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013906
Domain Number 1 Region: 117-217
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.38e-16
Family PDI-like 0.0059
Further Details:      
 
Domain Number 2 Region: 661-722
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000867
Family PDI-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013906   Gene: ENSPANG00000007707   Transcript: ENSPANT00000023622
Sequence length 932
Comment pep:known_by_projection chromosome:PapAnu2.0:20:11026548:11092948:-1 gene:ENSPANG00000007707 transcript:ENSPANT00000023622 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSECGGRGGGGSSSSEDAEDEGGGGGGPAGSDCLSPSPAPATASSAGRLRRGLRGASLMA
RQRPELLCGAVALGCALLLALKFTCSRAKDVIIPAKPPVSFFSPRSPVLDLFQGQLDYAE
YIRRDSEVVLLFFYAPWCGQSIAARAEIQQAASRLSDQVLFVAINCWWNQGKCRKQKHFF
YFPVIYLYHRSFGPIEYKGPMSAVYIEKFVRRVMKPLLYIPSQSELLDFLSNYEPGVLGY
FEFSGSPQPPGYLTFFTSALHSLKKDYLGTVRFGVITNKHLAKLVSLVHSGSVYLHRHFN
TSLVFPREVLNYTAENICKWALENQETLFRWLQPHGGKSLLLNNELKKGPALFLFIPFNP
LAESHPLIDEITEVALEYNNCHGDQVVERLLQHLRRVDAPMLESLALEAPAQLPDPPLIT
ASPCCNTVVLPQWHSFSRTHNVCELCVNQTAGGVKPSSVSMPQCSFFEMAAALDSFYLKE
QTFYHVASDSIECSNFLTSYSPFSYYTACCRTISRGVAGFIDSEQGVFEAPTVAFSSLEK
KCEVDAPSSIPHIEENRYLFPGVDMTSTNFTGLSCRTNKTLNIYLLDSNLFWLYAERLGA
PSSTQVKEFAAIVDVKEESHYILDPKQALMKLTLESFIQNFSVLYSPLKRHLIGSDSAQF
PSQHLITEVTTDTFWEVVLQKQDVLLLYYAPWCGFCPSLNHVFIQLARNLPMDTFTVARK
DLSVKYPEDLPITLPNLLKFILHHSDPASSPQNMANYPTKECLQSEAVLQRGHISHLERE
IQKLRAEISSLQRAQVQVESQLSSARRDEHRLRRQQRALEEQHSLLRAHSEQLQALYEQK
TGELQELARKLQELADASENLLTENTWLKILVATMERKLEGRDGAESLATRKEVRPKQPE
PSGTPQLPGSSPPPANVSATLVSERNNENRTD
Download sequence
Identical sequences A0A2I3MIC2
ENSPANP00000013906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]