SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013914 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013914
Domain Number 1 Region: 44-171
Classification Level Classification E-value
Superfamily TPR-like 7.59e-17
Family Tetratricopeptide repeat (TPR) 0.004
Further Details:      
 
Domain Number 2 Region: 841-880
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000143
Family HkH motif-containing C2H2 finger 0.075
Further Details:      
 
Domain Number 3 Region: 768-801
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000455
Family CCCH zinc finger 0.0059
Further Details:      
 
Domain Number 4 Region: 899-927
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000455
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013914
Domain Number - Region: 630-660
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.014
Family CCCH zinc finger 0.0077
Further Details:      
 
Domain Number - Region: 504-532
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0589
Family CCCH zinc finger 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013914   Gene: ENSPANG00000015185   Transcript: ENSPANT00000026892
Sequence length 966
Comment pep:known_by_projection chromosome:PapAnu2.0:20:11101456:11148457:-1 gene:ENSPANG00000015185 transcript:ENSPANT00000026892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSVSEERRKRQQNIKEGLQFIQSPLSYPGTQEQYAVYLHALVRNLFNEGNDVYRERDWN
NSISQYTEALNIADYAKSEEILIPKEIIEKLYINRIACYSNMGFHDKVLEDCNIVLSFNA
SNCKALYRKSKALSDLGRYKKAYDAVAKCSLAVPQDEHVIKLTQELAQKLGFKIRKAYVR
AELSLKSVPGDGATKALNHSVEDIEPDLLTPRQEAVPVVSLPAPSFSHEVGSELASVPVM
PLTSILPLQVEESTLPSAVLANGGKMPFTMPEAFLDDGDMVLGDELDDLLDSAPETNETV
MPSALVRGPLQTASVSPSMPFSASLLGTLPIGARYAPPPSFSEFYPPLTSSLEDFCSSLN
SFSMSESKRDLSTSTSREGTPLNNSNSSLLLMNGPGSLFASENFLGISSQPRNDFGNFFG
SAVTKPSSSVTPRHPLEGTHELRQACQICFVKSGPKLMDFTYHANIDHKCKKDILIGRIK
NVEDKSWKKIRPRPTKTNYEGPYYICKDVAAEEECRYSGHCTFAYCQEEIDVWTLERKGA
FSREAFFGGNGKINLTVFKLLQEHLGEFIFLCEKCFDHKPRMISKRNKDNSTACSHPVTK
HEFEDNKCLVHILRETTVKYSKIRSFHGQCQLDLCRHEVRYGCLREDECFYAHSLVELKV
WIMQNETGISHDAIAQESKRYWQNLEANVPGAQVLGNQMMPGFLNMKIKFVCAQCLRNGQ
VIEPDKNRKYCSAKARHSWTKDRRAMRVMSIERKKWMNIRPLPTKKQMPLQFDLCNHIAS
GKKCQYVGNCSFAHSPEEREVWTYMKENGIQDMEQFYELWLKSSEDVASQSNKENGKQIH
MPTDYAEVTVDFHCWMCGKNCNSEKQWQGHISSEKHKEKVFHTEDDQYCWQHRFPTGYFS
ICDRYMNGTCPEGNSCKFAHGNAELHEWEERRDALKMKLNKARKDHLIGPNDNDFGKYSF
LFKDLN
Download sequence
Identical sequences ENSPANP00000013914

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]