SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013917 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013917
Domain Number 1 Region: 7-68
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000919
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 2 Region: 68-126
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000611
Family B-box zinc-binding domain 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013917
Domain Number - Region: 109-218
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0262
Family Hemolysin E (HlyE, ClyA, SheA) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013917   Gene: ENSPANG00000005771   Transcript: ENSPANT00000023000
Sequence length 242
Comment pep:known_by_projection chromosome:PapAnu2.0:4:29584493:29599971:1 gene:ENSPANG00000005771 transcript:ENSPANT00000023000 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPLHKDNQEEGVCPICQESLKEAVSTNCGHLFCRVCLTQHVEKASACGVFCCPLCRKPC
SEEVLGTGYICPNHQKRVCRFCEESRLLLCVECLVSPEHVSHHELTIENALSHYKERLNR
RSRKLRKDIAELQRLKAQEEKKLQALQFQVDHGNHRLEAGLESQHQTREQLDALPQQWLG
QLEHMPAEVARILDISRAVTQLSSLVIDLERTAKELDTNTLKNAGDLLNRYELSLLLSHM
CI
Download sequence
Identical sequences ENSPANP00000013917

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]