SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013922 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013922
Domain Number 1 Region: 296-444
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-42
Family SPRY domain 0.0001
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000672
Family B-box zinc-binding domain 0.0021
Further Details:      
 
Domain Number 3 Region: 9-85
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000606
Family RING finger domain, C3HC4 0.025
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000013922
Domain Number - Region: 121-241
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.000719
Family Apolipoprotein A-I 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013922   Gene: ENSPANG00000010495   Transcript: ENSPANT00000006870
Sequence length 450
Comment pep:known_by_projection chromosome:PapAnu2.0:4:29611130:29620844:1 gene:ENSPANG00000010495 transcript:ENSPANT00000006870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSTPSLKVVHELPACTLCVGPLEDAVTAPCGHTFCRLCLPTLSQMGAQSSGKILLCPLC
QEEEQAETPMAPVPLGPLGETYCEEHGEKIYFFCENDAEFLCVFCREGPTHQAHTVGFLD
EAIQPYRDRLRSRLEALSMERDEIEDVKCREDQKLQVLLTQIENKKHQVEAAFERLQQEL
EQQRCLLLARLRELEQQIWKERDEYITKVSEEVTRLGAQVKELEEKCQQPASELLQDVRV
NQSRCEMKTFVSPEAISPDLVKKIRDFHRKILTLPEMMRMFSENLAHHLEIDSGVITLDP
QTASRSLVLSEDRKSVRYTRQKKNLPDSPLRFDGLPAVLGFPGFSSGRHRWQVDLQLGDG
GGCSLSAEDGVWAVIISHQQCWASTSPGTDLPLSEIPRYVGVALDYEAGQVTLFNAQTQE
PIFTFAASFSGKVFPFFAVWKKGSCLTLKG
Download sequence
Identical sequences ENSPANP00000013922

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]