SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013938 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013938
Domain Number 1 Region: 222-245
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000419
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013938   Gene: ENSPANG00000023072   Transcript: ENSPANT00000009673
Sequence length 252
Comment pep:known_by_projection chromosome:PapAnu2.0:4:30003689:30009022:1 gene:ENSPANG00000023072 transcript:ENSPANT00000009673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AETERGSLLQNAAATDVLCNLPEVEWWELRHCCPPTPRKRKQNPRVPLPHYPPNPAAAIA
AATMPKRKKQNQHQPPTQQQPPLPEREETGDVEDGSPIGPPSLLGPPPMANGKPGDPKSA
ALHRGPPGSRGPLIPPLLSLPPPPWGRGPIRRGLGPRSSPYGRGWWGVNVEPPFPGPGHG
GPTRGSFHKEQRNPRRLKSWSLIKNTCPPKDDPQVMEDKSDRPVCRHFAKKGHCRYKDLC
AFYHPGVNGPPL
Download sequence
Identical sequences ENSPANP00000013938

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]