SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013940 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013940
Domain Number 1 Region: 1-134,266-408
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.28e-64
Family CAF1-like ribonuclease 0.011
Further Details:      
 
Domain Number 2 Region: 170-255
Classification Level Classification E-value
Superfamily R3H domain 5.69e-34
Family R3H domain 0.0000149
Further Details:      
 
Domain Number 3 Region: 433-494
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000454
Family Canonical RBD 0.0000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013940   Gene: ENSPANG00000020099   Transcript: ENSPANT00000026977
Sequence length 495
Comment pep:known_by_projection chromosome:PapAnu2.0:20:13789070:13989269:-1 gene:ENSPANG00000020099 transcript:ENSPANT00000026977 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKH
SMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQG
FDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKF
IDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIV
ISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQF
YCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKGELVKKAQQLDLQMRLRQVPILPPF
LESAEGFPSYDTASEQLHEAGYDAYITGLCFISMANYLVGSFLSPPKIHVSARSKLIEPF
FNKLFLMRVMDIPYLNLEGPDLQPKRDHVLHVTFPKEWKTSDLYQLFSAFGNIQISWIDD
TSAFVSLSQPEQVKI
Download sequence
Identical sequences ENSPANP00000013940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]