SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013946 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013946
Domain Number 1 Region: 62-158
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 1.14e-17
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.0061
Further Details:      
 
Domain Number 2 Region: 904-926
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0000877
Family CCCH zinc finger 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013946   Gene: ENSPANG00000020095   Transcript: ENSPANT00000025880
Sequence length 934
Comment pep:known_by_projection chromosome:PapAnu2.0:4:30041706:30062422:-1 gene:ENSPANG00000020095 transcript:ENSPANT00000025880 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSGPIDPKELLKGLDSFLNRDGEVKSVDGISKIFSLMKEARKMVSRCTYLNILLQTRSP
EILIKFIDVGGYKLLNNWLTYSKTTNNIPLLQQILLTLQHLPLTVDHLKQNNTAKLVKQL
SKSSEDEELRKLASVLVSDWMAVIRSQSSTQPAEKDKKKRKDEGKSRTTPPERPLTEVKA
ETRAEEAPEKKREKPKSLRTTAPSHAKFRSTGLELETPSLVPVKKNASTVVVSDKYNLKP
IPLKRQSNVAAPGDATPPAEKKYKPLNTTPNATKEIKVKIIPPQPMEGLGFLDALNSAPV
PGIKIKKKKKVLSPTAAKPSPFEGKTSTEPSTAKPSSPEPAPPSEAMDIDRPGTPVPPVE
VPELMDTASLEPGALDAKPVESPGDPNQLTRKGRKRKSVTWPEEGKLREYFYFELDETER
VNVNKIKDFGEAAKREILSDRHAFETARRLSHDNMEEKVPWVCPRPLVLPSPLVTPGSNS
QERYIQAEREKGILQELFLNKESPHEPDPEPYEPIPPKLIPLDEECSMDETPYVETLEPG
GSGGSPDGAGGSKLPPVLANLMGSMGAGKGPQGPGGGGINVQEILTSIMGSPNSHPSEEL
LKQPDYSDKIKQMLVTVPHGLLGPGPIANGFPPGGPGGPKGMQHFPPGPGGPMPGPHGGP
GGPVGPRLLGPPPPPRGGDPFWDGPGDPMRGGPMRGGPGPGPGPYHRGRGGRGGNAFRGA
RGGRSGGGPPNGRGGPGGGMVGGGGHRPHEGPGGGMGNSSGHRPHEGPGSGMGSGHRPHE
GPGGSMGGGGGHRPHEGPGGGISGGSGHRPHEGPGGGMGAGGGHRPHEGPGGSMGGSGGH
RPHEGPGHGGPHGHRPHDVPGHRGHDHRGPPHEHRGHDGPGHGGGGHRGHDGGHSHGGDM
SNRPVCRHFMMKGNCRYENNCAFYHPGVNGPPLP
Download sequence
Identical sequences ENSPANP00000013946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]