SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000013948 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000013948
Domain Number 1 Region: 91-170
Classification Level Classification E-value
Superfamily Ribosomal protein S18 7.19e-23
Family Ribosomal protein S18 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000013948   Gene: ENSPANG00000017647   Transcript: ENSPANT00000005598
Sequence length 258
Comment pep:known_by_projection chromosome:PapAnu2.0:4:30063278:30071800:1 gene:ENSPANG00000017647 transcript:ENSPANT00000005598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASVLNTLLRRLPMLSLFRGAHRVQVPLQTVCTKPPSEEDSLSPVPISPYKDEPWKYLE
SEEYQERYGSRPVWADYRRNHKGGVPPQRTRKMCIRGNKVAGNPCPICRDHKLHVDFRNV
KLLEQFVCAHTGIIFHSLYTGVCVKQHKRLTQAIQKARDHGLLIYHIPQVEPRDRDFSIS
HGAVSATPPAPTLISGDPWYPWYNWKQPPERELSRLRRLYQGHLREESGPPPESMPKMPP
TAPAEASFTGQTDPQSAL
Download sequence
Identical sequences A0A096NLU0
ENSPANP00000013948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]