SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014010 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014010
Domain Number 1 Region: 43-142,239-354
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.65e-26
Family FAD/NAD-linked reductases, N-terminal and central domains 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014010   Gene: ENSPANG00000017769   Transcript: ENSPANT00000028884
Sequence length 450
Comment pep:novel chromosome:PapAnu2.0:7:19935485:19991754:1 gene:ENSPANG00000017769 transcript:ENSPANT00000028884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPLVAVVSGPRAQLFACLLRLGTQQAGPLQLHTGASHAARNHYEVLVLGGGSGGITMAA
RMKRKVGAENVAVVEPSERHFYQPIWTLVGAGAKQLSSSGRPMASVIPSGVEWIKARVIE
LNPDKNCIHTDNDEQISYRYLIIALGIQLHYEKIKGLPEGFAHPKIGSNYSVKTVEKTWK
ALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVK
KYADALQEIIRERNLTVNYKQNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMGP
PDVLKTSPVADAAGWVDVDKETLQHKRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTI
SLIMKNQTPTKKYDGYTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYVMKAD
LMPFLYWNMMLRGYWGGPAILRKLFHLGMS
Download sequence
Identical sequences A0A096NM01
ENSPANP00000014010

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]