SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014026 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014026
Domain Number 1 Region: 339-415
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 8.7e-19
Family PCI domain (PINT motif) 0.027
Further Details:      
 
Domain Number 2 Region: 123-186,233-344
Classification Level Classification E-value
Superfamily TPR-like 0.00000303
Family Tetratricopeptide repeat (TPR) 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014026   Gene: ENSPANG00000017736   Transcript: ENSPANT00000011707
Sequence length 443
Comment pep:known_by_projection chromosome:PapAnu2.0:7:23391327:23420918:-1 gene:ENSPANG00000017736 transcript:ENSPANT00000011707 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLEL
EGEKGEWGFKALKQMIKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYIS
TSKQMDLLQEFYETTLEALKDAKNDRLWFKTNTKLGKLYLEREEYGKLQKILRQLHQSCQ
TDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIKSAIPHPLIMGVIREC
GGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK
PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLI
KLIKPYTRIHIPFISKELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGAR
YTALDKWTNQLNSLNQAVVSKLA
Download sequence
Identical sequences A0A0D9RE31 A0A1S2ZCS2 A0A1U7QLH6 A0A1U7UQE3 A0A1V4JEE6 A0A218V889 A0A2K5EDW3 A7TX82 E2REA8 H0V0W1 H2NN68 H9G1W2 I3M5X6 K7CGU3 K7FTP0 K9IXT8 M3YLM4 P61201 P61202 P61203 U3DFN4 W5QIM2
GO.36758 HR2981 ENSPSIP00000011400 ENSPPYP00000007321 ENSCAFP00000021903 ENSP00000373553 ENSMPUP00000012231 ENSFCAP00000025122 NP_001098771.1.46622 NP_001180530.1.72884 NP_004227.1.87134 NP_004227.1.92137 NP_034069.2.92730 NP_695209.1.100692 NP_695209.1.4139 XP_001502205.3.31192 XP_002198608.1.42559 XP_002717858.1.1745 XP_002753495.1.60252 XP_002825472.1.23681 XP_002917590.1.58354 XP_003266943.1.23891 XP_003471818.2.53824 XP_003506288.1.69978 XP_003831540.1.60992 XP_003928918.1.74449 XP_003987204.1.62641 XP_004010675.1.66739 XP_004056207.1.27298 XP_004281347.1.21590 XP_004320626.1.83887 XP_004386359.1.4749 XP_004421614.1.5094 XP_004578147.1.84141 XP_004611846.1.94378 XP_004639069.1.9945 XP_004669790.1.11716 XP_004687873.1.23501 XP_004709478.1.18182 XP_004751409.2.14098 XP_005068621.1.91757 XP_005211949.1.76553 XP_005304066.1.60341 XP_005316603.1.77405 XP_005364461.1.66349 XP_005376737.1.28644 XP_005483423.2.73095 XP_005521573.1.90289 XP_005559570.1.63531 XP_005685857.3.57651 XP_005864027.1.60319 XP_005892213.1.15283 XP_006077871.1.26621 XP_006135119.1.96668 XP_006192386.1.101512 XP_006208425.1.17985 XP_006278225.1.47583 XP_006735671.1.47382 XP_006756088.1.95426 XP_006831736.1.41390 XP_006920444.1.64745 XP_007066867.1.26238 XP_007081889.1.5354 XP_007119683.1.24612 XP_007170497.1.59432 XP_007424356.1.37977 XP_007455608.1.90284 XP_007517390.1.11023 XP_007613863.1.28591 XP_007933388.1.48129 XP_008014835.1.81039 XP_008068086.1.4292 XP_008141346.1.99482 XP_008519734.1.77740 XP_008568661.1.73410 XP_008704160.1.72690 XP_009088191.1.15306 XP_010570182.1.12557 XP_010636791.1.5607 XP_010837824.1.44457 XP_010963587.1.22495 XP_010996871.1.51371 XP_011353386.1.92234 XP_011783976.1.43180 XP_011822692.1.47321 XP_011920667.1.92194 XP_011973978.1.54773 XP_012297596.1.9421 XP_012416516.1.74151 XP_012618977.1.48125 XP_014708201.1.49734 XP_014743241.1.99236 XP_014800007.1.91963 XP_014918934.1.86478 XP_015283407.1.55130 XP_015336169.1.40921 XP_015494127.1.82291 XP_015671699.1.16292 XP_015728487.1.68032 XP_015992749.1.101085 XP_016065609.1.3490 XP_017399275.1.71028 XP_017524329.1.32401 XP_017728255.1.44346 XP_019297704.1.44245 XP_019359715.1.87953 XP_019389185.1.79039 XP_019520207.1.44202 XP_019586238.1.88060 XP_020016164.1.5219 XP_020746990.1.74333 XP_021047762.1.100879 XP_021263618.1.32913 XP_021393189.1.53032 XP_021511615.1.76796 XP_021549756.1.83697 XP_510388.2.37143 XP_535470.1.84170 ENSCPOP00000003113 ENSP00000373553 ENSPANP00000014026 ENSPSIP00000011400 ENSRNOP00000012287 ENSPTRP00000012052 10141.ENSCPOP00000003113 9600.ENSPPYP00000007321 ENSPTRP00000012052 ENSCAFP00000021903 ENSMPUP00000012231 gi|4759264|ref|NP_004227.1| ENSMUSP00000028635 ENSOARP00000022574 ENSPPYP00000007321 ENSCPOP00000003113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]