SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014070 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014070
Domain Number 1 Region: 283-402
Classification Level Classification E-value
Superfamily TPR-like 5.38e-26
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 7-97,127-155
Classification Level Classification E-value
Superfamily HSP20-like chaperones 3.59e-20
Family GS domain 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014070   Gene: ENSPANG00000017293   Transcript: ENSPANT00000023287
Sequence length 420
Comment pep:known_by_projection chromosome:PapAnu2.0:7:29653121:29721643:-1 gene:ENSPANG00000017293 transcript:ENSPANT00000023287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLQVSDYSWQQTKTAVFLSLPLKGVCVRDTDVFCTENYLKVNFPPFLFEAFLYAPIDDE
SSKAKIGNDTIVFTLYKKEAAMWETLSVTGVDKEMMQRIREKSILQAQERAKEATEAKAA
AKREDQKYALSVMMKIEEEERKKIEDMKENERIKATKELEAWKECQRKAEEQKKIQKEQK
LCQKEKQIKEERKQLKYKTSTRNSASRNLAPKGRNSENIFTEKLKEDSIPAPRSVGSIKI
NFTPRVFPTALRESQVAEEEEWLHKQAEARRAMNADIPELCDLKEEEKNPEWLKDKGNKL
FATENYLAAINAYNLAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALELLMPPVTD
NANARMKAHVRRGTAFCQLELYVEGLQDYEAALKIDPSNKIVQIDAEKIRNVIQGTELKS
Download sequence
Identical sequences A0A096NM61
ENSPANP00000014070

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]