SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014073 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014073
Domain Number 1 Region: 524-653
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.09e-30
Family Hect, E3 ligase catalytic domain 0.0000207
Further Details:      
 
Domain Number 2 Region: 20-158
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.41e-29
Family Synaptotagmin-like (S variant) 0.05
Further Details:      
 
Domain Number 3 Region: 469-509
Classification Level Classification E-value
Superfamily WW domain 0.0000000000000195
Family WW domain 0.00012
Further Details:      
 
Domain Number 4 Region: 182-225
Classification Level Classification E-value
Superfamily WW domain 0.000000000000122
Family WW domain 0.0011
Further Details:      
 
Domain Number 5 Region: 342-382
Classification Level Classification E-value
Superfamily WW domain 0.00000000000032
Family WW domain 0.0018
Further Details:      
 
Domain Number 6 Region: 421-455
Classification Level Classification E-value
Superfamily WW domain 0.00000000000209
Family WW domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014073   Gene: ENSPANG00000017296   Transcript: ENSPANT00000023190
Sequence length 654
Comment pep:known_by_projection chromosome:PapAnu2.0:7:30032629:30185914:-1 gene:ENSPANG00000017296 transcript:ENSPANT00000023190 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATCAVEVFGLLEDEENSRIVRVKVIAGIGLAKKDILGASDPYVRVTLYDPMNGVLTSVQ
TKTIKKSLNPKWNEEILFRVHPQQHRLLFEVFDENRLTRDDFLGQVDVPLYPLPTENPRL
ERPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDA
ACHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQA
QRAFTTRRQISEETESVDNRESSENWEIIREDEATMYSSQAFPSPPPSSNLDVPTHLAEE
LNARLTIFGNSATSQSASSSNHSSRRGSLQAYTFEEQPALPVLLPTSSGLPPGWEEKQDE
RGRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSSQQVTQPSEIEQ
GFLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSSDLGPLPPGWE
ERTHTDGRIFYINHNIKRTQWEDPRLQNVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIP
NKFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEM
FNPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDG
Download sequence
Identical sequences ENSPANP00000014073

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]