SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014103 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014103
Domain Number 1 Region: 235-345
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000092
Family Synaptotagmin-like (S variant) 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014103   Gene: ENSPANG00000017059   Transcript: ENSPANT00000019609
Sequence length 348
Comment pep:known_by_projection chromosome:PapAnu2.0:7:36372119:36373213:-1 gene:ENSPANG00000017059 transcript:ENSPANT00000019609 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLEKLCSSNSGSSAPKPAFAKVLTPNRIPEFCIPPRLPAPCALESPSRAAALPRCCAA
ERDLWPRAADEDAGRTDWDPRSQAALSLPHLPRVLTAYGFCVLLESPHTRRKESLLLGDP
SAPRPRTRAYGGGCGPDAPLGTLCGPREDALVRRPHGCHLLRAPDGLLSRALRARRSRRL
ARARSVSSGNEDKERRAGSQSPARAPSASPSSSRDPLPERLEAEGTLALGRAGDALRLAA
EYCPETGRLRLRLLRAEGLAGGAPGLRAVRCRLSLVLRPPDTARRQCSIVVGRSRKASFD
QDFCFDGLSEDEVRRLTVRVKAWDEGRGRERGRLLGQGELSMGALLLL
Download sequence
Identical sequences ENSPANP00000014103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]