SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014156 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014156
Domain Number 1 Region: 423-866
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.03e-115
Family RNB domain-like 0.000000114
Further Details:      
 
Domain Number 2 Region: 223-321,364-416
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.97e-36
Family Cold shock DNA-binding domain-like 0.0024
Further Details:      
 
Domain Number 3 Region: 876-965
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000000994
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014156   Gene: ENSPANG00000016671   Transcript: ENSPANT00000003760
Sequence length 1055
Comment pep:known_by_projection chromosome:PapAnu2.0:7:40614715:40656194:1 gene:ENSPANG00000016671 transcript:ENSPANT00000003760 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQKEEKVLLLRTFQGRTLRIVREHYLRPCVPCHSPLCPQPAACSHDGKLLSSDVTHYVI
PDWKVVQDYLEILEFPELKGIIFMQTACQAVQHQRGRRQYNKLRNLLKDARHDCILFANE
FQQCCYLPRERGESMEKWQTRSIYNAAVWYYHHCQDRMPIVMVTEDEEAVQQYGSETEGV
FVISFKNYLDNFWPDLKAAHELCDSILQSRRERENESQESHGKEYPEHLPLEVLEAGIKS
GRYIQGILNVNKHRAQIEAFVRLQGASSKDSDLVSDILIHGMKARNRSIHGDVVVVELLP
KNEWKGRTVALCENDCDDKASGESPSEPMPTGRVVGILQKNWRDYVVTFPSKEEVQSQGK
NAQKILVTPWDYRIPKIRISTQQAEALQDFRVVVRIDSWESTSVYPNGHFVRVLGRIGDL
EGEIATILVENSISVIPFSEAQMCEMPVNTPENPWKVSREEEQKRKDLRKSHLVFSIDPK
GCEDVDDTLSIRTLNNGNLELGVHIADVTHFVAPNSYIDIEARTRATTYYLADRRYDMLP
SVLSADLCSLLGGVDRYAVSIMWELDKTSYEIKEVWYGRTIIRSAYKLFYEAAQELLDGN
FSVVDDIPEFKDLDEKSRQAKLEELVWAIGKLTDIARHVRAKRDGCGALELEGVEVRVQL
DDKKNIHDLIPKQPLEVHETVAECMILANHWVAKKIWESFPHQALLRQHPPPHQEFFSEL
RECAKAKGFFIDTRSNKTLADSLDNANDPHDPIVNRLLRSMATQAMSNALYFSTGSCAEE
EFHHYEGLALDTYTHFTSPIRRYSDIVVHRLLMAAISKDKKMEIKGNLFSNKDLEELCRH
INNRNRAAQHSQKQSTELFQCMYFKDKDPATEERCISDGVIYSIRTNGVLVFIPRFGIKG
AAYLKNKDGLVISSGPDSRSAWKPGSLQRFQNKITSTTTDGESVTFHLFDHVTVRISVQA
SRCHSDTIRLEIISNKPYKIPNTELIHQSSPLLKSELVKEVTKSMEEAQLAQEVKVNIIQ
EEYQEYCQTKGRSLYTLLEEIRDLALLDVSNNYGI
Download sequence
Identical sequences ENSPANP00000014156

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]