SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014167 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPANP00000014167
Domain Number - Region: 16-133
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000213
Family G proteins 0.0087
Further Details:      
 
Domain Number - Region: 253-295
Classification Level Classification E-value
Superfamily Globin-like 0.061
Family Globins 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014167   Gene: ENSPANG00000016628   Transcript: ENSPANT00000002106
Sequence length 306
Comment pep:known_by_projection chromosome:PapAnu2.0:7:41576892:41613507:-1 gene:ENSPANG00000016628 transcript:ENSPANT00000002106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCDCFALYSSDKSINYILGTEDLIVEVTSNDAVRFYPWTIDNKYYSADINLCVVPNKFLV
TAEIAESVQAFVVYFDSTQKSGLDSVSSWLPLAEAWLPEVMILVCDRVSEDGVNRQKAQE
WCIRHGFELVELSPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRNQGFNLLNS
LTGTNHSIGSADPCHPEQPHLPAADRTESLSDHRSGASNTTDAQVDSIVDPMLDLDIQEL
ASLTTGGGDVENFERLFSKLKEMKDKAATLPHEQRKVHAEKVAKAFWMAIGGDRDEIEGL
SSDEEH
Download sequence
Identical sequences ENSPANP00000014167

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]