SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014172 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014172
Domain Number 1 Region: 1-65
Classification Level Classification E-value
Superfamily SAP domain 2.84e-20
Family SAP domain 0.0000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014172   Gene: ENSPANG00000016583   Transcript: ENSPANT00000012956
Sequence length 651
Comment pep:known_by_projection chromosome:PapAnu2.0:7:42460210:42598273:1 gene:ENSPANG00000016583 transcript:ENSPANT00000012956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADSAELKQMVMSLRVSELQVLLGYAGRNKHGRKHELLTKALHLLKAGCSPAVQMKIKEL
YRRRFPQKIMTPADLSIPNVHSSPMPATLSPSTIPQLTYDGHPASSPLLPVSLLGPKHEL
ELPHLTSALHPVHPDIKLQKLPFYDLLDELIKPTSLASDNSQRFRETCFAFALTPQQVQQ
ISSSMDISGTKCDFTVQVQLRFCLSETSCPQEDHFPPNLCVKVNTKPCSLPGYLPPTKNG
VEPKRPSRPINITSLVRLSTTVPNTIVVSWTAEIGRNYSMAVYLVKQLSSTVLLQRLRAK
GIRNPDHSRALIKEKLTADPDSEIATTSLRVSLLCPLGKMRLTIPCRALTCSHLQCFDAT
LYIQMNEKKPTWVCPVCDKKAPYEHLIIDGLFMEILKYCTDCDEIQFKEDGTWAPMRSKK
EVQEVSASYNGVDGCLSSTLEHQVASHHQSSNKNKKVEVIDLTIDSSSDEEEEEPSAKRT
CPSLSPTSPLNNKGILSLPHQASPVSRTPSLPAVDTSYINTSLIQDYRHPFHMTPMPYDL
QGLDFFPFLSGDNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTS
LPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
Download sequence
Identical sequences A0A096NMG3 A0A0D9RLX1 A0A2I2YGW3 A0A2I3HR02 A0A2J8UCA9 A0A2K5KFP0 A0A2K6A9K8 A0A2K6BKM3 F7HEF3 H2Q9P3 O75925 Q4R996
ENSPTRP00000012341 ENSNLEP00000015951 9544.ENSMMUP00000015356 9606.ENSP00000249636 ENSP00000249636 gi|7706637|ref|NP_057250.1| ENSPANP00000014172 ENSMMUP00000015356 NP_001253230.1.72884 NP_001271586.1.63531 NP_057250.1.87134 NP_057250.1.92137 XP_002825636.1.23681 XP_003267188.1.23891 XP_008014316.1.81039 XP_011749974.1.29376 XP_011795732.1.43180 XP_011824060.1.47321 XP_523109.3.37143 ENSP00000249636 ENSNLEP00000015951 ENSMMUP00000015356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]