SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014207 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014207
Domain Number 1 Region: 527-637
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-19
Family Spermadhesin, CUB domain 0.0015
Further Details:      
 
Domain Number 2 Region: 168-291
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.5e-16
Family Spermadhesin, CUB domain 0.0075
Further Details:      
 
Domain Number 3 Region: 343-459
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.29e-16
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 4 Region: 289-351
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000959
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 5 Region: 643-701
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000148
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 6 Region: 703-764
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000236
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 7 Region: 771-829
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000445
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 8 Region: 464-529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000526
Family Complement control module/SCR domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014207   Gene: ENSPANG00000016354   Transcript: ENSPANT00000007973
Sequence length 923
Comment pep:known_by_projection scaffold:PapAnu2.0:JH684875.1:483730:513181:-1 gene:ENSPANG00000016354 transcript:ENSPANT00000007973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPRAQHPPPSQLLFLILLSCPWIQGLPLKEEEIFPEPGSETPTVASEALAELLHGALL
RRGPEMGYLPGSDPDPTLATPPAGQTLTVPSLPRATEPGTGPLTTAVTPKGVRGAGPTAP
ELLTPPPGTTAPPPPSPASPGPPLGPEGGEEETTTTIITTTTVTTTVTSPVLCNNNISEG
EGYVESPDLESPASRTLGLLDCTYSIHVYPGYGIEIQVQTLNLSQEEELLVLAGGGSPGL
APRLLANSSMLGEGQVLRSPTNRLLLHFQSPRVPRGGGFRIHYQAYLLSCGFPPRPAHGD
VSVTDLHPGGTATFHCDSGYQLQGEETLICLNGTRPSWNGETPSCMASCGGTIHNATLGR
IVSPEPGGAVGPNLTCRWVIEAAEGRRLHLHFERVSLDEDNDRLMVRSGGSPLSPVIYDS
DMDDVPERGLISDAQSLYVELLSETPANPLLLSLRFEAFEEDRCFAPFLAHGNVTTTDPE
YRPGALATFSCLPGYALEPPGPPNAIECVDPTEPHWNDTEPACKAMCGGELSEPAGVVLS
PDWPQSYSPGQDCVWGLHVQEEKRILLQVEILNVREGDMLTLFDGDGPSARVLAQLRGPQ
PRRRLLSSGPDLTLQFQAPPGPPNPGLGQGFVLHFKEVPRNDTCPELPPPEWGWRTASHG
DLIRGTVLTYQCEPGYELLGSDILTCQWDLSWSAAPPACQKIMTCADPGEIANGHRTASD
AGFPVGSHVQYRCLPGYSLEGAAMLTCYSRDTGTPKWSDRVPKCALKYEPCLNPGVPENG
YQTLYKHHYQAGESLRFFCYEGFELIGEVTITCVPGHPSQWTSQPPLCKVAYEELLDNRK
LEVTQTTDPSRQLEGGNLALAILLPLGLVIVLGSGVYIYYTKLQGKSLFGFSGSHSYSPI
TVESDFSNPLYEAGDTREYEVSI
Download sequence
Identical sequences A0A096NMJ8
ENSPANP00000014207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]