SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014217 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014217
Domain Number 1 Region: 1-91
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000784
Family THAP domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014217   Gene: ENSPANG00000016336   Transcript: ENSPANT00000024486
Sequence length 264
Comment pep:known_by_projection chromosome:PapAnu2.0:7:45335143:45347894:-1 gene:ENSPANG00000016336 transcript:ENSPANT00000024486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPARCVAAHCGNTTKSGKSLFRFPKDRAVRLLWDRFVRGCRADWYGGNDRSVICSDHFAP
ACFDVSSVIQKNLRFSQRLRLVAGAVPTLHRVPAPASKGEEERDQAGRPDTGGELQAARH
SETVPDPVSCTRPRAGKQAAASQVSVSLQEITCENEVVQTQPHADNPSNTVTSVPTHCEE
GPVHKSTQISLKRPHHRSVGIQAKVKAFGKRLCNATTQTDELWSRASSLFDIYSSDSEAD
TDWDIKSEQSDLSYIAVQVKEETC
Download sequence
Identical sequences ENSPANP00000014217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]