SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014261 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014261
Domain Number 1 Region: 232-353
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000171
Family Synaptotagmin-like (S variant) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014261   Gene: ENSPANG00000016013   Transcript: ENSPANT00000018982
Sequence length 1027
Comment pep:known_by_projection chromosome:PapAnu2.0:7:48697482:48817494:1 gene:ENSPANG00000016013 transcript:ENSPANT00000018982 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRGPEPWVSASLLSQRLKAEEKTLDLEFEVLSVGFNEGGRYALRLSAENPLQVGSGAG
VQLQVNDGDPFPACSAVTDVIEQQEPGQSLTLTRSKFIFTLPKGFCKNDGQHDAQLRVEA
LRLDEPSGRAAQRVGEAIFPIYPRPDQPRMNPKAQDHEDLYRYRGNLALLRASTDPTARH
CGSLAYSVTFHVHRDPQPPISDSPPGAGLPELMSNTEDPEEPLVASQSAEPKMGHLSPSN
KETITVTLHGATNLPACKDGSEPWPYVVVKSTSEEKNNQSSKAVTSVTSEPTRAPIWGDT
VNVEIQAEDAGQEDVILKVVDNRKKQELLSYKIPIKYLRVLHPYHFELVKPTQSGKADEA
TAKTQLYATVVRKSSFIPRDISCNHTALEIFLRGVNEPLANNPNPMVVIARVVPNYKEFK
VSQANRDLASVGLPITPLSFPIPSVMNFDEPRISQNGCPQLSKPGGPPEQPLWNQSFLFQ
GRDGATNFSEDTALVLEYYSSASMKGSQPWTLDQPLGISVLPLKSHLYQKMLTGKGLDGL
HVERLPIMDTSLKTVNGEAPTVDLSFQLLSSERPENFLTPNNSKALPTLDPKILDEKLGT
IQESWSKDTVSSTMDLSTSMPREVEEEPLVPETSRDTEMNNYRRAMQKMAEDILSLQRQA
SILEGENRILRSRLAQQEEEEEQGKASEAQNVVSMKQKLLLSELDMKKLRDRVQHLQNEL
IRKNDREKELLLLYQAQQPQAALLKQYQSKLQKMKGLEETVRHQEKVIEKMERVLEDRLQ
DRSKPPPPNRQQGKPYTGFPVFSASGLPLGSTGENLPVELYSVLLAENMKLRVELDKNRH
QPAPIILQQQALPVDPGELGAGGDLAERLRETHGPGHSECTETLPAQDLLSGTSDKFNLL
AKLERAQSRILSLESQLEDSARRWGREKQDLATRLQEQEKGFRHPSNSIIVEQPPYSLSP
APGASIFGKPRATVDPGGWREEAFQSRGRGDGPFPDPRKKQGHQRPVLLGDMREVCRFHL
PQNIYRV
Download sequence
Identical sequences ENSPANP00000014261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]