SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014300 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014300
Domain Number 1 Region: 99-167
Classification Level Classification E-value
Superfamily Homeodomain-like 4.71e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 1-38
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000285
Family LIM domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014300
Domain Number - Region: 35-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00392
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014300   Gene: ENSPANG00000015869   Transcript: ENSPANT00000021833
Sequence length 277
Comment pep:known_by_projection chromosome:PapAnu2.0:7:50804469:50808045:1 gene:ENSPANG00000015869 transcript:ENSPANT00000021833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVCSRQLLPGDEFSLREHELLCRAD
HGLLLERAAAGSPRSPGPLPGSRGLHLPDAGSGRQPALRPHVHKQTEKTTRVRTVLNEKQ
LHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKKSILMKQLQQQQHS
DKTSLQGLTGTPLVAGSPIRHENAVQGSAVEVQTYQPPWKALSEFALQSDLDQPAFQQLV
SFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences ENSPANP00000014300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]