SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014303 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014303
Domain Number 1 Region: 155-308
Classification Level Classification E-value
Superfamily EF-hand 1.26e-24
Family Calmodulin-like 0.033
Further Details:      
 
Domain Number 2 Region: 60-177
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000233
Family Calbindin D9K 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014303   Gene: ENSPANG00000015866   Transcript: ENSPANT00000025674
Sequence length 317
Comment pep:known_by_projection chromosome:PapAnu2.0:7:51411785:51429862:1 gene:ENSPANG00000015866 transcript:ENSPANT00000025674 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLGPRPAALGLLLLCAAAAGAGKAEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHE
EQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDKNGDDTVTWD
EYNIQMYDRVIDFDENTALDDAEEESFRKLHLKDKKRFEKANQDSGPGLSLEEFIAFEHP
EEVDYMTEFVIQEALEEHDKNGDGFVSLEEFLGDYRWDPTANEDPEWILVEKDRFVNDYD
KDNDGRLDPQELLPWVVPNNQGIAQEEALHLIDEMDLNGDKKLSEEEILENPDLFLTSEA
TDYGRQLHDDYFYHDEL
Download sequence
Identical sequences A0A096NMU3 A0A0D9RQD5 H9ETY2
ENSPANP00000014303 9544.ENSMMUP00000010763 ENSMMUP00000010763 ENSMMUP00000010763 XP_001105360.3.72884 XP_011755401.1.29376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]