SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014310 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014310
Domain Number 1 Region: 635-815
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 2.04e-47
Family Ypt/Rab-GAP domain of gyp1p 0.0025
Further Details:      
 
Domain Number 2 Region: 793-907
Classification Level Classification E-value
Superfamily Ypt/Rab-GAP domain of gyp1p 5.23e-28
Family Ypt/Rab-GAP domain of gyp1p 0.0065
Further Details:      
 
Domain Number 3 Region: 31-146
Classification Level Classification E-value
Superfamily PH domain-like 8.22e-18
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014310
Domain Number - Region: 246-279
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.00222
Family KRAB domain (Kruppel-associated box) 0.004
Further Details:      
 
Domain Number - Region: 487-549
Classification Level Classification E-value
Superfamily Tropomyosin 0.019
Family Tropomyosin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014310   Gene: ENSPANG00000015846   Transcript: ENSPANT00000027244
Sequence length 962
Comment pep:known_by_projection chromosome:PapAnu2.0:7:52391668:52469670:-1 gene:ENSPANG00000015846 transcript:ENSPANT00000027244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGAGSRAEEGGGGEGAAQGAAAEPGAGPAREPARLCGYLQKLSGKGPLRGYRSRWFVFD
ARRCYLYYFKSPQDALPLGHLDIADACFSYQGPDEAAELGAEPPAHFQVHSAGAVTVLKA
PNRQLMTYWLQELQQKRWEYCNSLDMVKWDSRTSPTPGDFPKGLVARDNTDLIYPHPNAS
AEKARNVLAVETVPGELVGEQAANQPAPGHPNSINFYSLKQWGNELKNSMSSFRPGRGHN
DGRRTVFYTNEEWELLDPTPKDLEESVVQEEKKKLTPEGNKGVTGSGFPFDFGRNPYKGK
RPLKDIIGSYKNRHSSGDPSSEGTSGSGSISIRKPGSEMQLQIQSQQEELERLKKDLCSQ
KELVRLLQQTVRSSQYDKYFTSSRLCEGVPKDTLELLHQKDDQILGLTSQLERFNLEKES
LQQEVRTLKSKVGELNEQLGMLMETIQAKDEVIIKLSEGEGSGPPPTVVPSSPSAAPVAR
DQLELDRLKDNLQGYKTQNKFLNKEILELSALRRNAERRERDLMAKYSSLEAKLCQIESK
YLILLQEMKTPVCSEDQGPTREVIAQLLEDALQVESQEQPEQAFVKPHLVSEYDIYGFRT
VPEDDEEEKLVAKVRALDLKTLYLTENQEVSTGVKWENYFASTVNREMMCSPELKNLIRA
GIPHEHRSKVWKWCVDRHTRKFKDSTEPGHFQTLLQKALEKQNPASKQIELDLLRTLPNN
KHYSCPTSEGIQKLRNVLLAFSWRNPDIGYCQGLNRLVAVALLYLEQEDAFWCLVTIVEV
FMPRDYYTKTLLGSQVDQRVFRDLMSEKLPRLHGHFEQYKVDYTLITFNWFLVVFVDSVV
SDILFKIWDSFLYEGPKVIFRFALALFKYKEEEILKLQDSMSIFKYLRYFTRTILDARKL
ISISFGDLNPFPLRQIRNRRAYHLEKVRLELTELEAIREDFLRERDTSPDKGELVSDEEE
DT
Download sequence
Identical sequences A0A096NMV0
ENSPANP00000014310

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]