SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014336 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014336
Domain Number 1 Region: 129-203
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.62e-30
Family AN1-like Zinc finger 0.0000737
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000138
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014336   Gene: ENSPANG00000015690   Transcript: ENSPANT00000018826
Sequence length 208
Comment pep:known_by_projection chromosome:PapAnu2.0:7:54543009:54583089:1 gene:ENSPANG00000015690 transcript:ENSPANT00000018826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSTLDSTSSSVQPSSVSNQSLLSESVASSQLDSTSVDKAVPETEDL
QASVSDTAQQPSEEQSKSLEKPKQKKNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHN
CSYNYKADAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences A0A096NMX6
ENSPANP00000014336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]