SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014337 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014337
Domain Number 1 Region: 126-196
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 3.66e-29
Family AN1-like Zinc finger 0.00014
Further Details:      
 
Domain Number 2 Region: 13-63
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000013
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014337   Gene: ENSPANG00000015690   Transcript: ENSPANT00000025840
Sequence length 201
Comment pep:known_by_projection chromosome:PapAnu2.0:7:54543009:54583089:1 gene:ENSPANG00000015690 transcript:ENSPANT00000025840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNHSQVPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQNSSNGRISPPATSVSSLSE
SLPVQCTDGSVPEAQSTLDSTSSSVQPSSVSNQSLLSESVASSQLDSTSVDKAVPETEDL
QASVSDTAQQPSEEQSKSLNRCFMCRKKVGLTGFECRCGNVYCGVHRYSDVHNCSYNYKA
DAAEKIRKENPVVVGEKIQKI
Download sequence
Identical sequences ENSPANP00000014337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]