SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014360 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014360
Domain Number 1 Region: 11-241
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.36e-78
Family BAR domain 0.0000000521
Further Details:      
 
Domain Number 2 Region: 284-344
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-21
Family SH3-domain 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014360   Gene: ENSPANG00000015606   Transcript: ENSPANT00000020028
Sequence length 347
Comment pep:known_by_projection chromosome:PapAnu2.0:7:57886136:58053996:-1 gene:ENSPANG00000015606 transcript:ENSPANT00000020028 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAGLKKQFHKASQLFSEKISGAEGTKLDDEFLDMERKIDVTNKAVAEILSKTTEYLQP
NPAYRAKLGMLNTVSKIRGQVKTTGYPQTEGLLGDCMLKYGKELGEDSTFGNALIEVGES
MKLMAEVKDSLDINVKQTFIDPLQLLQDKDLKEIGHHLKKLEGRRLDYDYKKKRVGKIPD
EEVRQAVEKFEESKELAERSMFNFLENDVEQVSQLAVFIEAALDYHKQSTEILQELQSKL
QMRISAASSVPRREYKPRPVKRSASELNGVSTTSVVKTTGSNIPMDQPCCRGLYDFEPEN
QGELGFKEGDIITLTNQIDENWYEGMIHGESGFFPINYVEVIVPLPQ
Download sequence
Identical sequences A0A096NN00 A0A0D9RXK0 A0A2K5KPH8
ENSPANP00000014360 XP_007988401.1.81039 XP_011947425.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]