SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014371 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014371
Domain Number 1 Region: 544-721
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.97e-41
Family SPRY domain 0.00035
Further Details:      
 
Domain Number 2 Region: 349-541
Classification Level Classification E-value
Superfamily Fibronectin type III 1.34e-25
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 3 Region: 151-201
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000755
Family B-box zinc-binding domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014371
Domain Number - Region: 183-290
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0615
Family Apolipoprotein A-I 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014371   Gene: ENSPANG00000000970   Transcript: ENSPANT00000008164
Sequence length 727
Comment pep:known_by_projection chromosome:PapAnu2.0:7:58730332:58760449:1 gene:ENSPANG00000000970 transcript:ENSPANT00000008164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLHDSEDRLQLFPEENTRMRKEVVQAEMANESRGAGDGKAQRDLQEEVDELVHLYGLED
DHELRDEFVDENLPRTGVSEYPPYVMKRRDPAREQRDWRPSGETAEAEDLGFGGWGSAGQ
CQDLREAYRYTHGRASEEYECYVIPEEEDEEEAADVFCVTCKTPIRAFQKVFDEHKEHEV
IPLNEALESAKDEIHKNMYKLEKQIIQMENFANHLEEVFITVEENFGKQEQHFESHYNEI
LETLAQKYEEKIQALGEKKKEKLEALYGQLVSCGENLDTCKELMETIEEMCHEEKVDFIK
DAVAMADRLGKFLKAKTDVEISAQPEFEDQTLDFSDVEQLMGSINTIPAPSAPVINPQAP
NSATGSSVRVCWSLYSDDTVESYQLSYRPVQDSSPGKDQAAFTVTVKETYCSVTNLVPNT
QYEFWVTAHNRAGPSPSSEHAVYMTAPSPPIIKTKEIRSCEEAVLICWESGNLNPVDSYT
VELTQAESPEASGVTESVVGIPTCESLVQLQPGRSYIICVRALNMGGPSVRSEPATVHTI
GSYFRLNKDTCHPWLIISEDGLTVVRSERRIPARELSSSDTRFTRCVAVMGNLIPVRGHH
YWEVEVDEHLDYTVGVAFEDVTKQEDLGANCLSWCMRHTFASSRHRYEFLHNRTTPDIRI
TVPPKKIGILLDYENSKLSFFNVDLSQHLYTFSCQLHEFVHPCFSLETPGCLKVHNGISM
PKHVTFY
Download sequence
Identical sequences A0A096NN11
ENSPANP00000014371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]