SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014387 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014387
Domain Number 1 Region: 92-220
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.79e-44
Family Regulator of G-protein signaling, RGS 0.00000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014387   Gene: ENSPANG00000024132   Transcript: ENSPANT00000028933
Sequence length 230
Comment pep:known_by_projection chromosome:PapAnu2.0:10:204378:207324:1 gene:ENSPANG00000024132 transcript:ENSPANT00000028933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ELAPRSLGNLLRPPMPTPHEAEKQNTGPEEADRPPSMSSHDAAPPAAPSRNPCCLCWCCC
CSCSWNQERRRAWQASRESKLQPLPSCEVCATPSPEEVQSWAQSFDKLMHSPAGRSVFRA
FLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGIN
KKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALLLQGPSQSSSE
Download sequence
Identical sequences ENSPANP00000014387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]