SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014391 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014391
Domain Number 1 Region: 693-912
Classification Level Classification E-value
Superfamily TPR-like 1.54e-33
Family HAT/Suf repeat 0.026
Further Details:      
 
Domain Number 2 Region: 502-707
Classification Level Classification E-value
Superfamily TPR-like 1.19e-22
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 
Domain Number 3 Region: 410-525
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000225
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number 4 Region: 287-411
Classification Level Classification E-value
Superfamily TPR-like 0.0000000121
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014391   Gene: ENSPANG00000024135   Transcript: ENSPANT00000017714
Sequence length 941
Comment pep:known_by_projection chromosome:PapAnu2.0:10:243831:299084:-1 gene:ENSPANG00000024135 transcript:ENSPANT00000017714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQM
KKNQAADDDDEDLNDTNYDEFNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERR
EQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSIPEVGDARNKRQRNPRYEKLT
PVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKS
VRETNPHHPPAWIASARLEEVTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKA
VVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHVPNSVRLWKAAVELEEPEDAR
IMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAAVRAVIGIGIEEEDRK
HTWMEDADSCVAHNALECARAIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRA
VAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPNSEEIWLAAVKLESENDEYER
ARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMENAREAYNQGLKKCPHSTPLWLLLSRLEEKVGQLTRARAILEKSRLKNPKNPGLW
LESVRLEYRAGLKNIANTLMAKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHD
PHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAFFYKFELQHGTEEQQEEVRKR
CESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIRNAF
Download sequence
Identical sequences A0A096NN31
ENSPANP00000014391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]