SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014410 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014410
Domain Number 1 Region: 2016-2160
Classification Level Classification E-value
Superfamily C-type lectin-like 4.37e-43
Family C-type lectin domain 0.000000329
Further Details:      
 
Domain Number 2 Region: 477-583
Classification Level Classification E-value
Superfamily C-type lectin-like 6.07e-42
Family Link domain 0.0014
Further Details:      
 
Domain Number 3 Region: 150-260
Classification Level Classification E-value
Superfamily C-type lectin-like 6.91e-40
Family Link domain 0.0015
Further Details:      
 
Domain Number 4 Region: 588-702
Classification Level Classification E-value
Superfamily C-type lectin-like 1.66e-30
Family Link domain 0.0045
Further Details:      
 
Domain Number 5 Region: 262-355
Classification Level Classification E-value
Superfamily C-type lectin-like 5.8e-28
Family Link domain 0.0024
Further Details:      
 
Domain Number 6 Region: 33-151
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000615
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 
Domain Number 7 Region: 2161-2221
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000639
Family Complement control module/SCR domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014410   Gene: ENSPANG00000025598   Transcript: ENSPANT00000006664
Sequence length 2246
Comment pep:known_by_projection chromosome:PapAnu2.0:7:63245623:63316926:1 gene:ENSPANG00000025598 transcript:ENSPANT00000006664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTLLWVFVTLRVIAAAVTVETSDHDNSLSVSIPQPSPLRVLLGTSLTIPCYFIDPMHPV
TTAPSTAPLAPRIKWSRVSKEKEVVLLVATEGRVRVNSAYQDKVSLPNYPAIPSDATLEI
QSLRSNDSGVYRCEVMHGIEDSEATLEVVVKGIVFHYRAISTRYTLDFDRAQRACLQNSA
IIATPEQLQAAYEDGFHQCDAGWLADQTVRYPIHTPREGCYGDKDEFPGVRTYGIRDTNE
TYDVYCFAEEMEGEVFYATSPEKFTFQEAANECRRLGARLATTGQLYLAWQAGMDMCSAG
WLADRSVRYPISKARPNCGGNLLGVRTVYLHANQTGYPDPSSRYDAICYTGEDFVDIPEN
FFGVGGEEDITVQTVTWPDMELPLPRNITEGEARGSVILTVKPIFDVSPSPLEPEEPFTF
APEIGATAFPEVENETGEATRPWGFPTPGLGPATAFTSEDLVVQVTAVPGQPHLPGGVVF
HYRPGSTRYSLTFEEAQQACLRTGAVIASPEQLQAAYEAGYEQCDAGWLRDQTVRYPIVS
PRTPCVGDKDSSPGVRTYGVRPSTETYDVYCYVDRLEGEVFFATRLEQFTFQEALEFCES
HNATLATTGQLYAAWSRGLDKCYAGWLADGSLRYPIVTPRPACGGDKPGVRTVYLYPNQT
GLPDPLSRHHAFCFRGVSAVPSPGEEEGGTPTSPSGVEDWIATQVVPGVAAVPVEEETTA
VPLGETTAILEFTTEPENQTEWEPAYTPMGTSPLPGILPTWPPTGTATEESTEGPSATEV
LTVSKEPSPPEVPFPSEEPSPSEEPFPSVRPFPSVEPSPSEEPFPSKEPSPSEEPSASEE
PYTPSPPVPSWTELPGSGEESGAPDVSGDFIGSGDVSGHLDFSGQLSGDRASGLPSGDLD
SSGLTSTVGSGLPVDSGLASGDEERIEWSSTPTVGELPSGAEILEGSASEVGDLSGLPSG
EVLETSASGVGDLSGLPSGEVLETSASGVGDLSGLPSGEVLETSASGVGDLSGLPSGEVL
ETSTSGVGDLSGLPSAGEVLETTASGVEDISGLPSGEVLETTASGVEDISGLPSGEVLET
TVSGVEDISGLPSGEVLETTASGVEDISGLPSGEVLETTASGVGDLGGLPSGEVLETSTS
GVGDLGGLPSGEVLETSTSGVEDLSGLPSGGEVLETSTSGVEDISGLPSGEVLETTASGI
EDVSELPSGEGLETSASGVEDLSRLPSGEVLETSASGVGDISGLPSGGEVLEISASGIGD
LSGLPSGGEGLETSASGVGTDLSGLPSGREGLETSASGAEDLSGLPSGKEDLVGPASGDL
DLGRLPSGTLGSGQAPETSGLPSGFSGEYSGVDLGSGPPSGLPDFSGLPSGFPTVSLVDS
TLVEVVTASTASELEGRGTIGISGAGEISGLPSSELDISGEASGLPSGTELSGQASGSPD
VNGETPGLFDVSGQPSGFPDTSGETSGVTELSGLSSGQPGVSGEASGVPYGSSQPFGITD
LSGETSGVPDLSGQPSGLPGFSGATSGVPDLVSGATSGSGESSGITFVDTSLVEVTPTTF
KEEEGLGSVELSGLPSGEADLSGRSGMVDVSGQFSGTVDSSGFTSQTPEFSGLPIGIAEV
SGESSGAETGSSLPSGAYYGSGLPSGFPTVSLVDRTLVESVTQAPTAQEAGEGPSGILEL
SGTHSGAPDMSGDHSGFLDLSGLQFGLVEPSGEPPSTPYFRGDFASTTDVSGESSAAVGT
SGEASGLPEVTLITSEFMEGVTEPTVSQELGQRPPVTHTPQLFESSGEASAAGDISGATP
VLPGSGVEVSSVPESSSETSAYPEAGVGASAAPETSGEDSGSPDLSETTSAFHEADLERS
SGLGVSGSTLTFQEGEPSASPEVSGESTTTGDVGTEAPGLPSATPTASGDRTEISGDLSG
HTSGLGIVISTSIPESEWTQQTQRPAEAHLETESSSLLYSGEETHTAETATSPTDASIPA
SPEWTGESESTVAAPTRSCAEEPCGAGTCKETEGHVICLCPPGYTGEHCNIDQEVCEEGW
TKYQGHCYRHFPDRETWVDAERRCREQQSHLSSIVTPEEQEFVNNNAQDYQWIGLNDRTI
EGDFRWSDGHPMQFENWRPNQPDNFFAAGEDCVVMIWHEKGEWNDVPCNYHLPFTCKKGT
VACGEPPVVQHARTFGQKKDRYEINSLVRYQCTEGFVQRHVPTIRCQPSGHWEEPRITCT
DATAYKRRLQKRSSRHPRRSRPSTAH
Download sequence
Identical sequences ENSPANP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]