SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014417 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014417
Domain Number 1 Region: 229-387
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.98e-57
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000222
Further Details:      
 
Domain Number 2 Region: 68-227
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-52
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000563
Further Details:      
 
Domain Number 3 Region: 25-73
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000652
Family EGF-type module 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014417   Gene: ENSPANG00000026189   Transcript: ENSPANT00000010452
Sequence length 387
Comment pep:known_by_projection chromosome:PapAnu2.0:7:63343518:63360220:-1 gene:ENSPANG00000026189 transcript:ENSPANT00000010452 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPCLLAALCGALLCAPSLLVALDICSKNPCHNGGLCKEISQEVRGDVFPSYTCTCLEG
YAGSHCEMKCIEPLGMENGNIANSQITASSVRVTFLGLQHWVPELARLNRAGMVNAWTPS
SNDDNPWIQVNLLRRMWVTGVVTQGASRLASHEYLKAFKVAYSLNGHEFNFIHDVNEKHK
EFAGNWNKNAVHVNLFETPVEAQYVRLYPTSCHTACTLRFELLGCELDGCFNPLGLKNNS
IPDKQITASSSYKTWGLHLFSWNPSYARLDKQGNFNAWVAGSYSNDQWLQVDLGSLKEVT
GIITQGARNFGSVQFVASYKVAYSNDSVNWTEYQDPRTGSSKIFPGNWDNHSHKKNLFET
PILARYVRVLPVAWHNRIALRLELLGC
Download sequence
Identical sequences A0A096NN57
ENSPANP00000014417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]