SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014419 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014419
Domain Number 1 Region: 1433-1740,1811-1908
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.46e-78
Family RNB domain-like 0.0000984
Further Details:      
 
Domain Number 2 Region: 2320-2410,2445-2797
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.39e-60
Family Extended AAA-ATPase domain 0.098
Further Details:      
 
Domain Number 3 Region: 689-764,810-1110
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.19e-42
Family Extended AAA-ATPase domain 0.043
Further Details:      
 
Domain Number 4 Region: 1299-1401,1434-1461
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000317
Family Cold shock DNA-binding domain-like 0.015
Further Details:      
 
Domain Number 5 Region: 204-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000313
Family HkH motif-containing C2H2 finger 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014419   Gene: ENSPANG00000020634   Transcript: ENSPANT00000007206
Sequence length 2822
Comment pep:known_by_projection chromosome:PapAnu2.0:10:687247:706514:1 gene:ENSPANG00000020634 transcript:ENSPANT00000007206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGCRPTFPRPLCYQVCRYYSPGLGCRRHRNRCTFARSREEALVWTFERQHNLQRLWLKA
EVQGGGAQGGAGRAADAILTEFGGRFELLCSLCFRRCPPRVCRVDPQGQCPEHGACPSLL
AHVSAEGRRKQQFVTVRPQPRAGQPPAYCRFVGRGQPCWRGESRCQFAHSAVEMAVWEAE
QLGGLQRGDLLTPPAPDGDGRTVPLGQPPGAQLYCPACLVTCHSQEAFENHCASSEHAQM
VAFDQAVPWEHRSPPPGLSKFELCPKPDLCEYGDACTKAHSAQELQEWIQRRRAVELRGQ
AAWQDGLVPYQERLLAEYQRSSSEVLVLTETLDGVRVTCNQPLMYQAQERKTQYSWTFAV
HSEEPLLHVALLKQEPGANFSLVAPGLPSGRLYARGERFRLPSSAADFQVGVSVQAASFG
TFEQWVVFDFGRRPVLLRKLGLQLGQGRHPEPCSSLALGHPEEMERWHTGNRHVVPAVER
TAEQTALMAKYKDPALALEFNRSGLASGPISPTNYRQRMHQFLYEEETAQQQLVAKLTLR
GPVFLKTALQTPALNMLFAPPGALYAEVPVPPSLMPDTDQGFLLGRAVSTALVAPVPAPN
NAVFEVRLEKRASSEQVLWLLLPARCCLALGLQPEARLVLEVQFQIDPMTFRLWHQAVDT
LPEEQLVVPDLPTCALPRPWSVPPLRRGNRKQELAVALIAGWGPGDGKRVPPLLIYGPFG
TGKTYTLAMASLEVIRRPQAKVLICTHTNSAADIYIREYFHSHVSGGHPEATPLRVMYTD
RPPSHTDPVTLQYCCLTDDHQAFRPPTWAELARHRVVVTTTSQARELRVPVGFFSHILID
EAAQMLECEALTPLAYASRSTRLVLAGDHMQVTPRLFSVARARAAEHTLLHRLFLYYQQE
THEVARQSRLVFHENYRCTEAIVSFVSRHFYVAKGNPIHARGKVPPHPRHYPLMFCHVAG
SPDRDISMTSWLNLAEIAQAVEKVQEAYNTWPSCWGVREQRHICVVSQGAQVSALRQELR
RRDLGQVSVGSFEILPGRQFRVVVLSAVHTCQSLLSPGALAPEFFTDARVLNTVLTRAQS
QLVVVGDAVALCSFGACGKLWESFIRECVERHSVCPEGLSMEQVEQGVAQRRRWPPRGTR
AGAAGNWEAAPEPVGDPAEEPATVVTATVKAEPGDEALSPASGDITATPAQTEAAAAPAG
DAVKEDVVPGAWAVGAAAAAGVESTEPEDAEADFWPWDGELNADDAILRELLDESRKVMV
TVGEDGLLDTVARPESPRQARLYENLPPAALRRLLRAEPERYRHCTFVQETFERASAIPL
DDASSGPIQVRGRLDCGMAFTGDEVLVQLLSGDRAPEGRLRGRVLGVLKRRRQELAFVCR
MDRWDPRIMVPINGSVTKIFVAELKDPSRVPVYGLRKGRLQRVGLERLTAEARHSRLFWV
HIVLWRPGFYYPLGIVREVLPEASTWEQGLRILGLEYSLRVPPSDLAAITKALQKYQSEL
GRVAGRREDCRAFLTFTVDPQGACNLDDALSVRDLGPRCEVAVHITDVASFVPRDGVLDV
EARRQGAAFYAPGREPVPMLPASLCQDILSLLPGRDRLAISLFLTMEKASGQLKSLHFAP
SVVRSDRQLSYEEAEQVIRQHPGAGRELPAHLDSVDACVVAACYFSRLLRRHRLQSDCFY
EQPDEDSTLGFRAAHIMVKEYMIQFNRLVAEFLVGSERTRTVTPLRWQPAPHSQQLKALC
EKHGERVPLSLHLSHHLRGGGGSAPDTQLHLLASLWKQVQFAARTQDYEQMVDLVTTDDM
HPFLAPAGRDLRKALERSAFGRCTWGHQQQGGHYSLQVEWYTWATSPIRRYLDVVLQRQI
LLALGHGGSAYSARDIDGLCQGFSLQHALAQSYQRRAQSLHLAVQLKAQPLDKLGFVVDV
EAGSRCFRLQFPSNRETLPDPCPVPYSSLQLAEHPRALAGRPGMQLLWRRRVYSVQGSGP
PLPLPGTVLDPHTWAVEMALWKQLLALVELQRWPEAAALIQEKGEASPRRGLVQVQRSRC
GHFLEVAQELGSGDTLQVQLGASLQHGFLVPSPQLWTVAPGFSLCLEHVERPGDCFLGHV
YQAPRDRYRDVDEYTCVWEPFCALESATGAVAENDAVTLQHLSVSWDVSRMPQGQLQGAF
RLEAAFLEENCVDINLSCCYLCIRLEGLPAPTASPRPGPSSLGPGLSVDPGTYTWVAHGQ
TEDCDQESRADRQEAPRQVHLFIHHMGMEKVPEEVLRPGTLFTVELLPKQLPDLRKEEAV
RGLEEASPLVTSIALGRPVPQPLCRVIPSRFLERQTYDIPGGRHKLNPSQNRAVREALEK
PLTVIQGPPGTGKTIVGLHIIFWFHKSNQEQVQPGGSPHGETQLGGPCILYCGPSNKSVD
VLAELLLRRTELKPLRVYGEQAEASEFPVPRLGSRKLLRRNPREGRPNQSLRSITLHHRI
RQAPNPYSSEIKAFDTRLQSGELFSREDLVLYKKVLWEARKFELDRHEVILCTCSCAASA
SLKTLDVRQILVDEAGMATEPETLIPLVRFPQAEKVVLLGDHKQLRPVVKNEWLQNLGLD
RSLFERYHEDAHMLDTQYRMHEGICAFPSMAFYKSRLKTWQGLKRPPSVLGHAGKESCPV
IFGHVQGHERSLLVSTDEGNENSKANLEEVAEVVRITKQLTLGRTIEPQDVAVLTPYNAQ
ASEISKALRREGITGVAVSSITKSQGSEWRYVLVSTVRTCAKSDLDQRPTKSWLKKFLGF
VVDPNQVNVAVTRAQEGLCLIGDHLLLRCCPLWRSLLDFCEAQQSLVPAGQVRICRRPTM
PS
Download sequence
Identical sequences A0A096NN59
ENSPANP00000014419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]