SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014451 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014451
Domain Number 1 Region: 656-759
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 2.75e-27
Family Elongation factor TFIIS domain 2 0.0047
Further Details:      
 
Domain Number 2 Region: 263-322
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.19e-16
Family PHD domain 0.0000269
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014451   Gene: ENSPANG00000026186   Transcript: ENSPANT00000014202
Sequence length 2213
Comment pep:known_by_projection chromosome:PapAnu2.0:10:1375000:1435730:1 gene:ENSPANG00000026186 transcript:ENSPANT00000014202 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDDKGDPSNEEAPKAIKPTSKEFRKTWGFRRTTIAKREGAGDAEADPLEPPPPQQQLGLS
LRRSGRQPKRTERVEQFLTIARRRGRRSAPVSLEDSGEPTSCPATDAETASEGSVESASE
TRSGTQSASTPVKERPASSEKVKGGDDHDDTSDSDSDGLTLKELQNRLRRKREQEPTERP
LKGIQSRLRKKRREEGPAETVGSEASDTVEGVLPSKQEPENDQGTASQAGKDDRESKLEG
KAAQDVKEEEPGDSGRPKPECEGYDPNALYCICRQPHNNRFMICCDRCEEWFHGDCVGIS
EARGRLLERNGEDYICPNCTILQVQDETNSETADQQEAKLRPGDADGTDCTSIGTIEQKS
SEDQGIKGRIEKAANPSGKKKLKIFQPVIETPGASKCIGPGCCQVAQPDSVYCSNDCILK
HAAATMKFLSSGKEQKPKPKEKMKMKPEKPSLPKCGVQAGIKISSVHKRPAPTTVKKAVV
VPARSEALGKEAACESSTPSWASDHNYNAVKPEKTAAPSPSLLYKSTKEDRRSEEKAAAT
AASKKTAPPGSAVGKQPAPRNLVPKKSSFANVAAATPAVKKPPSGFKGTIPKRPWLSATP
SSGASVARQAGPAPAAASKKFPGSAALVGAVRKPVVPSVPTASPAPGRLGAMSAAPSQPN
SQIRQNIRRSLKEILWKRVSDSDDLIMTENEVGKIALHIEKEMFNLFQVTDNRYKSKYRS
IMFNLKDPKNQGLFHRVLREEISLAKLVRLKPEELVSKELSTWKERPTRSVMESRTKLHN
ESKKTAPRQEAIPDLEDSPPVSDSEEQQESARAVPEKSTAPLLDVFSCMLKDTTSQHRAH
LFDLNCKICTGQVPSAEDEPALSASVKKEDLKSKPDSSAPDPAPDPADEVMPEALPEVAS
EPGLESVSHPNADRTYFPGPLGDGHPEPSPLEDLSPCPASCGSGLVTTVTVSGRDPRTAP
SSSCTAVASAAARPDSTHMVEARQDVPKPVLTSVMVPKSILAKPSSSPDPRYLSVPPSPN
ISTSESRSPPEGDTTLFLSRLSTIWKGFINMQSVAKFVTKAYPVSGCFDYLSEDLPDTIH
IGGRIAPKTVWDYVGKLKSSVSKELCLIRFHPATEEEEVAYISLYSYFSSRGRFGVVANN
NRHVKDLYLIPLSAQDPVPSKLLPFEGPGLESPRPNIILGLVICQKIKRPANTGELDKVD
EKRTRLQQEEVDVPAYPKVTTAPQSEKKPSKYQLYSADTAVSSTPPGSPPPPPPLPEPPV
LKVLSSLKPSTAASSAASSASKTASPLEHILQTLFGKKKSFDPSVREPPGSTAGLPQEPK
TTAEDGVLAPPLLDPIVQQFGQFSKDKALEEEEDDRPYDPEEEYDPERAFDTQLVERGRR
HEVERAPEAAAAEREEVAYDPEDETILEEAKVTVDDLPNRMCADVRRNSVDRPAEPVAGA
ATPSLVEQQKMLEELNKQIEEQKRQLEEQEEALRQQRAAVGVSMAHFSVSDALMSPPPKS
SLPKAELFQQEQQPADKPTSLPPASQASNHRDPRQARRLVAEAGDGEGEPPSRLSARGAQ
GALPERDACRGGLVGQAPVPVLEEKEPASSPWASGEKPPAGSEQDGWKAEPGEGTRPATA
GDSSARPARRVLLPTPPCGALQPSFPLQHDGERDPFTSPGFASQDKALGSAQYEDPRNLL
SAGRSSSPAVETEGDREPQARPGEGTTPLPTPGQKVGGAQPQFQGQREPGPHVLGMSGLH
GPNFPGPRGPAPPFPEESIASNDGPRGPPPARFGAQKGPIPSLFSGQHGPPPYGDSRGPS
PSYLGGPRGVAPSQFEERKDPHGEKREFQDAPYNEVSGTPAQFEGTEQAPFLGGRGGAPF
QFGGQRRPLLSQLKGPRGGPPPSQFGGQRGPPPGHFVGPRGPHPSQFEATRGPHPNQFEG
PRGQVPNFMPGPRGIQPQQFEDQRVHSPPRFTNQRAPAPLQFGGLRGSAPFSEKNEQTPS
RFHFQGQAPQVMKPGPRPLLELPSHPPQHRKDRWEEAGPPSALSSSAPGQGPEADGQWAS
PDFREGKGHEYRNQTFEGRQRERFDAGPKEKPLEEPDAQGRASEDRRRERERGRNWSRER
DWDRAREWDRHRDKDCSRDWDRNRERSANRDREREADRGKEWDRSRERSRNRERERDRRR
DRDRSRSRERDRDKARDRERGRDRKDRSKSKESARDPKPEASRASDAGAASQA
Download sequence
Identical sequences ENSPANP00000014451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]