SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014498 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014498
Domain Number 1 Region: 48-222,339-386
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000835
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Weak hits

Sequence:  ENSPANP00000014498
Domain Number - Region: 186-301
Classification Level Classification E-value
Superfamily TPR-like 0.00834
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014498   Gene: ENSPANG00000026184   Transcript: ENSPANT00000026421
Sequence length 447
Comment pep:known_by_projection chromosome:PapAnu2.0:7:73384194:73477459:-1 gene:ENSPANG00000026184 transcript:ENSPANT00000026421 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQESQETHISNHLDEVVAAVSITHSKKFQNKLPQTALFQPPREKLHLCEEKAKSYSNSHE
YKQAIHELVRCVALTRICYGDSHWKLAEAHVNLAQGYLQLKGLSLQAKQHAEKAKQILAN
SIVPPYNENTDVFKFSIELFHTMGRALLSLQKFKEASENLTKAERLSKELLQCGRIIKEE
WIEIEARIRLSFAQVCQGQKKSKEALSHYQAALEYVEISKGEKSHECVPILRELAGVEQA
LGLHDVSINHFLQAHLIILSRSPSKVEAADSAHIVAHAAVASGRHEHHDVAEQYFQESMA
HLKDSEGMGRTKFLSIQDEFCHFLQMTGQKSRATSILRESLEAKVGVFGNFSPEVAETYR
LLGGADLVQGNHSEAHKKLKKCLQIQTVLYGPQDKRTLATQQAMGIFSTAPKVAAKPRQA
SKAKVAFCTSIPQDTMLAKARPGTTAD
Download sequence
Identical sequences ENSPANP00000014498

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]