SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014526 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014526
Domain Number 1 Region: 59-392
Classification Level Classification E-value
Superfamily Subtilisin-like 1.83e-93
Family Subtilases 0.000000000859
Further Details:      
 
Domain Number 2 Region: 388-538
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.06e-41
Family Proprotein convertase P-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 594-758
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.95e-35
Family Growth factor receptor domain 0.00027
Further Details:      
 
Domain Number 4 Region: 733-842
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000628
Family Growth factor receptor domain 0.00081
Further Details:      
 
Domain Number 5 Region: 1-42
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.000000000629
Family Prohormone convertase 1 pro-domain 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014526   Gene: ENSPANG00000011167   Transcript: ENSPANT00000023807
Sequence length 870
Comment pep:known_by_projection chromosome:PapAnu2.0:7:75594335:75779107:-1 gene:ENSPANG00000011167 transcript:ENSPANT00000023807 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IGNLEDYYHFYHSKTFKRSTLSSRGPHTFLRMDPQVKWLQQQEVKRRVKRQVRSDPQALY
FNDPIWSNMWYLHCGDKNSRCRSEMNVQAAWKRGYTGKNVVVTILDDGIERNHPDLAPNY
DSYASYDVNGNDYDPSPRYDASNENKHGTRCAGEVAASANNSYCIVGIAYNAKIGGIRML
DGDVTDVVEAKSLGIRPNYIDIYSASWGPDDDGKTVDGPGRLAKQAFEYGIKKGRQGLGS
IFVWASGNGGREGDYCSCDGYTNSIYTISVSSATENGYKPWYLEECASTLATTYSSGAFY
ERKIVTTDLRQRCTDGHTGTSVSAPMVAGIIALALEANGQLTWRDVQHLLVKTSRPAHLK
ASDWKVNGAGHKVSHFYGFGLVDAEALVVEAKKWTAVPSQHMCVAASDKRPRSIPLVQVL
RTTALTSACAEHSDQRVVYLEHVVVRISISHPRRGDLQIYLISPSGTKSQLLAKRLLDLS
NEGFTNWEFMTVHCWGEKAEGQWTLEIQDLPSQVRNPEKQGKLKEWSLILYGTAEHPYHT
FSAHQSRSRMLELSAPELEPPKAALSPSQMEVPEDEEDYTAHSTPGSANILQTSVCHPEC
GDKGCDGPNADQCLNCIHFSLGSVKTSRKCVSVCPLGYFGDTAARRCRRCHKGCETCSGR
GATQCLSCRRGFYHHQEMNTCVTLCPAGFYADESQKNCLKCHPSCKKCVDEPERCTVCKE
GFSLARGSCIPDCEPGTYFDSELIRCGECHHTCGTCVGPGREECIHCAKNFHFQDWKCVP
ACGEGFYPEEMPGLPHKVCRRCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD
ETFCEMVKSNRLCERKLFIQFCCRTCLLAG
Download sequence
Identical sequences ENSPANP00000014526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]