SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPANP00000014528 from Papio anubis 76

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPANP00000014528
Domain Number 1 Region: 400-686
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.88e-84
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000013
Further Details:      
 
Domain Number 2 Region: 223-397
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 2.88e-54
Family Threonyl-tRNA synthetase (ThrRS), second 'additional' domain 0.00016
Further Details:      
 
Domain Number 3 Region: 688-796
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 8.46e-27
Family Anticodon-binding domain of Class II aaRS 0.0011
Further Details:      
 
Domain Number 4 Region: 162-222
Classification Level Classification E-value
Superfamily TGS-like 0.00000000000283
Family TGS domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPANP00000014528   Gene: ENSPANG00000022401   Transcript: ENSPANT00000009970
Sequence length 805
Comment pep:known_by_projection chromosome:PapAnu2.0:7:75937577:76034337:-1 gene:ENSPANG00000022401 transcript:ENSPANT00000009970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAETLAAEAVASRLERQEEDIRWLWAEVQRLRDEQLNAPYSCQAEGPCLTREVAQLRAE
NRDLRHRLCRLRLCLAEELSRQATLESAELAGAQEAGAQRPSSQSQDEDMKNKKMKESEP
DSEVKQPIFIKERLKLFEILKKDHQLLLSIYGKKGDTSNIITVRVTDGQTVQGEVWKTTP
YQVAAEISQELAESTVIAKVNGELWDLDRPLEGDSSLELLTFDNEEAQAVYWHSSAHILG
EAMELYYGGHLCYGPPIENGFYYDMFIEDRAVSSTELSALENICKAIIKEKQPFERLEVS
KEILLEMFKYNKFKCRILNEKVDTATTTVYRCGPLIDLCKGPHVRHTGKIKTIKIFKNSS
TYWEGNPEMETLQRIYGISFPDNKMMRNWEKFQEEAKNRDHRKIGKDIKMKLFFFVIIPP
GSILFLRTGTKIYATLEFIVTEEYHKRDFTEVLSPNMYNSKLWEASGHWQHYSENMFTFE
IEKDTFALKPMNCPGHCLMFAHRPRSWREMPMRFADFGVLHRNELSGTLSGLTRVRRFQQ
DDAHIFCTVEQIEEEIKGCLQFLQSVYSTFGFSFQLNLSTRPENFLGEIEMWNEAEKKKQ
LQNSLMEFGEPWKMNPGDGAFYGPKIDIKIKDAIGRYHQCATIQLDFQLPIRFNLTYVSK
DGDDKKRPVIIHRAILGSVERMIAILSENYGGKWPFWLSPRQVMVIPVGPTCEKYALQVS
SEFFEEGFMADVDLDHNCTLNKKIRNAQLAQYNFILVVGEKEKINNAVNVRTRDNKIHGE
ILVTSAIDKLKNLKKSRTLIAEEDF
Download sequence
Identical sequences ENSPANP00000014528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]